KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_0346Help
Entry
MASS_0346         CDS       T02682                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mabb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MASS_0346
  Amino acid metabolism
   00380 Tryptophan metabolism
    MASS_0346
Enzymes [BR:mabb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MASS_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
377252..378715
Genome map
AA seq 487 aa AA seqDB search
MSNRTTTNTGIAVESDDESLTAGTQGPVLLHDHYLIEKLAQFNRERVPERIVHAKGAGAY
GELVITADVSKYTKAKLFQPGAKTESLARFSTVAGEQGSPDSWRDPRGFAVKFYTEDGNY
DLVGNNTPVFFIRDAIKFPDFIRSQKRLPGSGLRDHNMQWDFWTLRPETAHQVTWLMGDR
GIPKTYRHMNGYGSHTYQWINAEGERFWVKYHFKTDQGHDFLTQQEADELAGSDADAHRR
DLWNAIEEGNFPSWTLHVQIMPVDEAAGYRFNPFDLTKVWSKKDYPLIEVGKWTLNRNPR
NYFVEIEQAAFEPSNIVPGIGFSPDKMLLGRVFAYADAHRYRIGTNYAQLPPNAPRAATV
NSYSKEGPMRYHFNDPEIPVYAPNSFGGPHADPEAAGDGGVWEFDGTAVRAGYVQHAEDG
DFVQAGTLVRDVLDDEQRARLAGNIVGHVLDGVSEPVLSRVFEYWKNVDPELGKAVEEGV
RAGLDAT
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccgcaccacaacgaataccggaatcgcggtcgagagtgacgacgagtcgctg
accgcgggtacgcagggcccggtgttgctgcatgaccattacctgatcgagaagcttgcc
cagttcaaccgggagcgggttcccgagcgcatcgtgcacgccaagggcgccggggcatac
ggggagctcgtgatcaccgccgacgtctcgaagtacaccaaagcgaagttgttccagccc
ggagcaaaaaccgaatctttggctcgcttttcgactgtcgccggggagcagggtagcccc
gatagctggcgcgatccgcgcggattcgcggtcaagttctacaccgaagacggcaactac
gatctcgtcggcaacaacactccggtgtttttcatccgcgatgccattaaattcccggac
ttcatccgatcgcagaaacggctgcccggttccgggttgcgtgaccacaacatgcagtgg
gatttctggacgctacgccccgagactgcgcaccaggtcacctggctgatgggggatcgc
ggcattccgaagacgtatcggcacatgaacggctacggctcgcacacctaccagtggatc
aatgccgagggcgagcgcttctgggtcaaataccacttcaagacggaccagggccatgat
ttcctcacgcagcaagaagcggatgagcttgcgggctcggacgccgacgcccatcgccgc
gatctgtggaatgcgatcgaggaaggcaacttcccgagctggaccctgcacgtacagatc
atgccggtggacgaagcggcgggatatcggttcaatccctttgatctgaccaaggtttgg
tcaaagaaggactacccgctgatcgaggtcggcaagtggacgctcaaccgcaacccgcgc
aactacttcgtggaaattgagcaggcggcgttcgagccttcgaatatcgtgcccggaatc
ggtttttcgccggacaagatgctgttgggccgcgtgttcgcctatgcggacgcacatcga
taccgcatcggcaccaactatgcccagctaccgccgaacgcgccgcgcgccgcaacggtg
aactcctactccaaggaggggccgatgcgctaccacttcaacgatccggaaattcccgtc
tacgcgcccaattcctttggcggcccgcacgccgatccagaagccgccggtgacggcggc
gtctgggagttcgacggtacggcagtgcgcgccgggtacgtccagcatgcggaggacggc
gacttcgtgcaggcgggaacgttggtgcgtgacgtgctcgacgacgagcagcgtgcgcga
ctggcgggcaatatcgtcggacacgtgttggacggagtctccgagcccgtgttgtccagg
gtcttcgagtactggaagaacgtggaccccgagctgggtaaggcggttgaagagggagtt
cgcgcaggtctggacgccacgtag

DBGET integrated database retrieval system