KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_0593Help
Entry
MASS_0593         CDS       T02682                                 

Definition
putative 3-ketosteroid delta(4)(5alpha)-dehydrogenase
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mabb00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MASS_0593
Enzymes [BR:mabb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     MASS_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
637264..638904
Genome map
AA seq 546 aa AA seqDB search
MLLFWLHDDEGGPVPGRSDMPSADVVIVGYGVAGASAALAALERGASVIILERFDGGGAS
AISGGIYYAGGGTNIQRDAGVEDTPELMLEYLRLEVGDAVKPETLQKFVDGSVDTLDWLQ
GYGVPFEGSLAPFKTSYPTDDYYLYFSGSESSGMARAATPPRQRGHRAFGRGVSGKALFA
PLADSAERLGADVWRQTRVTGLVVEEGRVVGVRGMTLKDAPAWARRLYSRLTHYATKPGI
YYPPMRKTLEGPAYALERRFAKPFEIRAGDGVILSSGGFIANRELVRRHAPAYLDGLELG
TAGDDGTALKLAEPLGAATGHLDEISAWRFIVPPAAFLGSLLVDTKGQRMIDESRYGAAL
GKEIVRTAGGVGYLVADQPLVKRARQQLGSQTLWFQRIQAEAFLNVGRKKAGSIEELAAK
AGIDPEGLARTVSEHNRAIADGAPDPLGKPDDIRVPIERAPFYLFNVSIKTNMLNPCPML
TLGGLVVDEETGAVQTTSGAAIPGLYAAGRAAVGICSNSYVSGLSLADCVFSGRRAGTET
GRRIDA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgttttggttacacgacgatgagggaggccccgtgccgggtcgttcggacatg
ccgtcggccgatgtcgtcatcgtcgggtatggggtggcgggtgcgtccgccgcgctggct
gccctggagcgcggggcgtccgtgatcatccttgagcgattcgatggtggcggagcttcg
gccatctcaggaggcatttattacgccggcggcggcaccaatattcaacgtgacgccggg
gtcgaggacactccggagctgatgctggagtacctgcggcttgaggtcggcgatgccgtc
aaacccgagacgcttcagaaattcgtcgacggcagcgtggacactctggattggctgcaa
ggttacggagttccgttcgaaggttcgctggcacctttcaagacttcgtacccgaccgac
gactactacctctacttttccggcagtgaatcctccggcatggcgcgtgccgccaccccg
ccccgccagcgcgggcaccgtgcctttggccggggggtgtccggcaaggcgttgtttgcg
cccttggcggactccgcggagcgtttgggggccgacgtatggcggcagaccagggtcacc
gggctggtcgtcgaggaggggcgcgttgtcggggtgcgcgggatgacgctgaaggacgcg
ccggcctgggcccgccggttgtactcgcgtcttacgcactatgcgaccaagccgggcatc
tactacccgccgatgcgaaagacgctcgaaggtcccgcgtatgcgttggagcgccggttc
gccaagccatttgagatccgtgccggcgacggagtgatcctgtcgtccggtggttttatc
gccaatcgtgagctcgtacggcggcatgcgccggcctatctggacgggctcgagctcggc
accgccggcgacgacggaaccgcactgaagctggccgagccgttgggagcggcaacgggg
catctcgacgagatctcggcctggcggtttattgtgccgcctgccgctttcctgggctcc
ttgctggtagataccaaggggcagcggatgattgacgagtctcgctatggagcggccttg
ggcaaggagattgtgcgtacggccggcggagtgggatatctggttgccgaccagccgttg
gtgaagcgggcccgccaacagttgggatcgcagacgctgtggtttcagcggattcaggcc
gaggcgttcctcaacgtggggcgcaagaaggccgggtccatcgaggagctggcagccaag
gctggtatcgacccggaaggattggcgcgcaccgtatccgaacacaaccgggccattgcc
gacggcgcccccgatccgctggggaagcccgatgacattagggtgcccattgagcgggcg
ccgttctatctgttcaacgtgtccatcaagaccaacatgctcaatccgtgtccgatgctg
actcttggcggtctggtcgtggacgaggagactggtgccgtgcagaccacgtcgggcgcg
gcgatcccggggctctatgccgccgggcgtgcggcggtcggtatctgctcaaattcgtat
gtgagcggattgtccctggccgactgcgtcttctccggacgccgggccgggaccgagact
ggaaggcgtatagatgcttag

DBGET integrated database retrieval system