KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_0595Help
Entry
MASS_0595         CDS       T02682                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mabb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MASS_0595
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MASS_0595
   00650 Butanoate metabolism
    MASS_0595
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MASS_0595
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MASS_0595
   00622 Xylene degradation
    MASS_0595
   00621 Dioxin degradation
    MASS_0595
Enzymes [BR:mabb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MASS_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
639693..640601
Genome map
AA seq 302 aa AA seqDB search
MASKASVAIVGSGNISTDLLYKLQRSEWLEPRWMIGIDPESEGLKRARGFGLETSHEGVD
WLLGQDEKPDLVFEATSAYVHKAAAPRYEEAGIRAIDLTPAAVGPAVVPPANLRAHLDAP
NVNMITCGGQATIPIVYAVSRVVEVPYAEIVASVASVSAGPGTRANIDEFTKTTSKGVEV
IGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRAAIAASIHDVVSQVQQYVPGYRLL
NEPQFDEPSVVNGGNHVVTTFVEVEGAGDFLPPYAGNLDIMTAAATKVGEEIAKELLSVK
VS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtcaaaggcatctgtagcgatcgtcggttcgggaaacatcagcaccgacctgctg
tacaaattgcagcgttccgagtggctggagccgcggtggatgatcggcatcgatcccgag
tccgaaggtctcaagcgtgcccgcggtttcggtctggaaacctcgcacgagggtgtggac
tggttgcttgggcaggacgagaagccggatctggtcttcgaggcaacgtccgcctacgtg
cacaaggccgccgcgccacgctatgaggaagcgggcatccgggccatcgatctgactccc
gcagcggtgggaccggccgttgtgccgcccgcgaatctgcgtgcccaccttgatgctccg
aacgtcaacatgatcacctgcggtggccaggcgacgattccgatcgtgtacgcggtgtcg
cgcgttgtcgaggtgccttacgccgagatcgtcgcctcggtcgcctcggtgtccgcggga
cccggaacgcgcgccaatatcgacgagttcaccaagaccacgtccaagggggtggaggtg
atcggaggcgccaagcgcggaaaggcgatcatcatcctgaaccccgcggatccgccgatg
atcatgcgcgacacaattttctgcgccattcctgaggacgcggaccgtgcggcgattgcc
gcgtcgattcacgatgtggtgagccaggttcagcagtacgtgcccggataccggctgctc
aatgagccgcagttcgatgagccgtcggtggtcaacggcggcaaccatgtcgtcaccacc
ttcgtcgaggttgagggcgccggtgacttcttgccgccgtatgccggaaacctggacatc
atgaccgcggccgcgaccaaggtcggcgaggaaatcgccaaagaacttctatctgtaaag
gtttcgtga

DBGET integrated database retrieval system