KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_1041Help
Entry
MASS_1041         CDS       T02682                                 

Definition
class II aldolase/adducin domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mabb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MASS_1041
Enzymes [BR:mabb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MASS_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1081759..1082565)
Genome map
AA seq 268 aa AA seqDB search
MASTLHDTKSELMDRAERSMQTHFSDSQWTTRQKVALTCRALFDRGHDSGLAGQITARAE
EPGTFYTQRLGLGFDEITEENLLLVDEDLNVLEGSGMANPANRFHSWIYRARPDVQCIVH
THPFHVAALSMLETPLIVSQMDIAPLYDDCAFLPDWPGVPVGNEEGEIISAALGDKKAIL
LAHHGHVVAGASVEESCSLAVLIERGAQLQLAAMAAGTIAPLPDRLAREAHDWTLTPKRS
TANFAYYARTALAHHPETLTSLTTQGNS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggccagtacccttcacgacaccaaatccgaactgatggatcgtgccgagcgcagcatg
cagacccacttctccgactcgcaatggaccacccgccagaaggtggcgctgacatgccga
gcgctcttcgaccgcggccacgattcgggcctcgccggacaaatcaccgcgcgcgccgag
gaacccggcaccttctacacccagcgactgggcctgggattcgacgagatcaccgaggag
aacctgcttctcgtcgacgaggatctcaacgttctcgaaggctcaggaatggccaacccc
gccaatcgcttccacagctggatctaccgggcccgtccggatgtgcaatgcatcgtgcac
acccatccgttccacgtcgccgcactgtccatgctggagacgccactgatcgtgtcgcag
atggacatcgcgccactgtatgacgactgcgccttcctgccggactggccgggcgttccc
gtcggcaacgaggagggcgaaatcatctccgccgccctcggagacaaaaaggcgatcctg
ctcgcccaccacggtcacgtcgtcgcgggcgcttccgtcgaagagtcctgctcgctggcg
gtgttgatagagagaggcgcccagctgcaactggccgcgatggccgcgggaaccatcgcg
ccactgcccgaccggctggctcgggaggcccacgactggactctcacccccaaacgcagc
accgccaacttcgcctactacgcccgcaccgcgctcgcccatcaccccgagacactcacc
agcctgaccacacaagggaattcctaa

DBGET integrated database retrieval system