KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_1112Help
Entry
MASS_1112         CDS       T02682                                 

Definition
(GenBank) 3-oxo-5-alpha-steroid 4-dehydrogenase 2
  KO
K12343  3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Brite
Enzymes [BR:mabb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MASS_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Steroid_dh DUF1295 PEMT
Motif
Other DBs
NCBI-ProteinID: AGM27714
UniProt: R4UIJ0
Position
1157952..1158713
Genome map
AA seq 253 aa AA seqDB search
MLTELYHTAIVFLVVLAVVTFVSGFWFTNPYGRFAKPDETFTAPAKLGWLIFECPQWWAF
TVTFWTVAHHHGAPALMLYGLWQCHYLYRGLLYPLWRKDSGKRFPYSGIAFGFLFNAING
FANGYAVACAAHLQSGAWFTDPRFVFGVLIAVVGWIVNFQADRILINLRSDGFGGYRIPY
GGAFRWVSAANYLGEIILWAGWALMSWTLPGLIFVLFSIANLLPRALSIHRWYRQTFPTE
YPRERKAIVPGLL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgcttacagagctgtatcacacggcgatcgttttcctggtggttctggccgtcgtcacc
tttgtcagtggcttctggtttaccaacccgtacggacgtttcgccaaaccggacgagacg
ttcaccgcgcccgccaagctcggctggctgatcttcgaatgcccgcagtggtgggcgttc
accgtcacgttctggactgtcgcacatcaccacggcgcaccggcactgatgctgtacggc
ctgtggcagtgccactatctgtaccgcggcctgctctatccgctctggcgcaaggacagc
ggaaaacgattcccctacagcgggattgcattcggattcctgttcaacgcaatcaacggt
tttgccaacgggtatgcggttgcttgtgcggcgcatctacagagcggagcctggttcacc
gatccccggttcgtgttcggggtgcttatcgccgtcgtcggctggatcgtgaatttccag
gccgatcgcattctcatcaatctgcgctccgacggtttcggcggttaccgcattccgtac
ggtggtgccttccgctgggtgtcggcggccaactaccttggcgagatcattctctgggcg
ggctgggcgttgatgtcgtggacgctgccagggttgatcttcgtgctgttctccatcgcg
aatctgctgccgcgcgccctgtccattcatcgctggtatcgccagacctttcctaccgag
tatccgcgtgagcgcaaggcgatcgtgccggggctgctgtag

DBGET integrated database retrieval system