KEGG   Mycobacteroides abscessus subsp. bolletii 50594: MASS_1707Help
Entry
MASS_1707         CDS       T02682                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mabb  Mycobacteroides abscessus subsp. bolletii 50594
Pathway
mabb00330  Arginine and proline metabolism
mabb00332  Carbapenem biosynthesis
mabb01100  Metabolic pathways
mabb01130  Biosynthesis of antibiotics
mabb01230  Biosynthesis of amino acids
Module
mabb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mabb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MASS_1707
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MASS_1707
Enzymes [BR:mabb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MASS_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGM28309
UniProt: R4UK79
Position
1735224..1736330
Genome map
AA seq 368 aa AA seqDB search
MNPGAQAREAIRSARTVVVKVGTAALTDETGTFSADRMEYLVEVIEGRMKAGSDVVIVSS
GAIAAGMVPLGLTKRPTDLATKQAAASAGQVALIGAWSAAFARYERTVGQVLLTAHDISM
RVHHTNAQRTLDRLTALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSD
IDGLYDSDPRKGNARFISEVSGPADLADVIAGPGGSRGTGGMASKLSSALLASDAGVPVL
LASATEAAAALGDGSCGTVFAARPQRMSARKFWVRYAAEATGSLTLDAGAVRAVVASRRS
LLPAGITGVSGRFHGGDVVELRDADGTMVGRGVVAYDVAELATMLGRSTNELPEDLRRPA
VHADDLVT
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccaggtgcgcaggcgcgtgaggccattcgctcggcgcgcaccgtcgtggtgaag
gtcggcaccgccgcactcaccgatgagacggggaccttcagtgccgaccgcatggaatac
ctcgtcgaggtcatcgaaggccggatgaaggctggatccgatgtggtgatcgtgtcctcc
ggggcgatcgcggcgggcatggttccgctcggattgaccaaacgcccaacggatctggcg
accaagcaggcggcggccagtgcgggtcaagtggcccttatcggcgcctggagtgcggcc
ttcgcgcgttatgaacgcaccgtgggccaggtgctgctgaccgcccacgacatctcgatg
cgcgtgcaccacaccaacgcgcagcgcaccctcgacagactcaccgcattgcacgcggtt
gccatcgtgaacgagaacgacaccgtggccaccaacgagattcgtttcggagacaatgac
cgcctctcggcgctcgtcgcgcatttggtgggtgccgatgcgctggtgttgctctccgac
atcgatgggctctacgattcagacccccgaaaggggaacgcgcgcttcatttctgaggtg
agcggccccgcggacctggccgacgtgatcgccggccccggcggctcgcgtggtactgga
ggcatggcatccaagctctcctcggcgctgctggcttccgacgccggtgtgccggtgctc
ttggcctcggcgacagaggcggcggcggcactgggagacggctcctgcggaactgttttc
gcggcgcggccgcaacgcatgtccgcccgcaagttctgggtacgttacgccgccgaggcc
accggttcactgacgctggacgctggcgcggtacgcgcggtcgtggcgtcccggcgttca
ttgctgcctgccggtatcaccggggtatccggacgcttccacgggggcgatgtcgttgag
ctccgcgacgcggacggcaccatggtcggccggggcgtggtcgcctatgacgtcgctgaa
ttggcgaccatgctgggccgctccaccaacgaactccccgaggatctgcggcgccccgcc
gtgcacgccgacgacctcgtcacctga

DBGET integrated database retrieval system