KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_1711Help
Entry
MASS_1711         CDS       T02682                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mabb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MASS_1711
Enzymes [BR:mabb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MASS_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1738511..1739377)
Genome map
AA seq 288 aa AA seqDB search
MTELATVCVLGSVNMDLTLRVEELPAPGATVLATSAMPAPGGKGANQAVAAARAGASVQF
IGAVGSDGAAPMLRSHLSDNNVGLDGLVEVDGPSGMATITVEDSGENCIVVAPGANTAFT
LDEKVHKDIICSHDVLLCQLEIPVRVALTAARWAAEAGKQFVLNASPVPERSPDLAELAF
RASVVVVNETEAQSWLYPSRHLVTTLGDEGSRYRSPQGQITVPSYPVRPLDTTGAGDVFA
GVLAAWWPQGAETALRRANVAGALATLRAGAGNCAPTGARIELSLKGS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagttagccacggtatgcgtcctcggtagcgtcaacatggatctgacgttgcgg
gtggaggagcttcccgcccctggagcaacggtgctggcgacatcggccatgcccgctccg
ggaggcaagggcgccaatcaggccgtggcagcagcacgtgcgggcgcctcggtgcagttc
atcggcgcggtgggctccgatggcgcggcaccgatgctgcgatctcacctgtcggacaac
aatgttggtctggacggcctggtcgaggtcgacggccccagcggaatggccaccatcacc
gtggaggactccggtgagaactgcattgtggtggcgcccggggccaacaccgccttcacc
ctggacgagaaggtgcacaaggacatcatctgctcgcacgacgtgctgctgtgccagctg
gaaattccggtgcgggtggcgctgaccgcggcccgctgggccgccgaggccggaaagcaa
ttcgtgctcaacgcttctcccgtacccgagcgctcccccgacctagcggagctggccttt
cgggcgagcgtggtcgtcgtcaacgaaaccgaggcgcagtcctggctgtacccgtcgcgc
catctggtgaccaccctcggcgacgagggttctcggtaccgcagtccgcaagggcagatc
acggtgccgtcctatccggtgcggccgctggacaccaccggcgccggtgacgttttcgcc
ggagtgctggccgcctggtggccccagggtgccgaaactgccctccggcgtgcgaatgtg
gccggggcgctggccacgctgcgcgcgggagccggaaactgcgcgccgaccggggccagg
atcgagctgtcgctcaaggggtcctga

DBGET integrated database retrieval system