KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_2760Help
Entry
MASS_2760         CDS       T02682                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Brite
Enzymes [BR:mabb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MASS_2760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2812390..2813181
Genome map
AA seq 263 aa AA seqDB search
MHWYTGNSIYDTVLTAAFAFAAFVIVGGFFAQSSYGRFSTTKLGLNLNPKLGWWLMEIPA
TVVFLVCYLTGPARFEPTSLVLAGIWLLHYANRGWFFPLAIRQVPGKRSTFNVSVVVMGM
LVTSMHGYLNGTLFSHDFFGQYTSAWLRDPRFLLGLVVYLCGFTLLLSSESIVRNLRDKK
NPGAAEYRIPFGGGFRFVTSPAYLGELIAWSGFALLTWALPGVVILLITAGNLIPRALAT
HRWYQEKFIDYPADRKALIPKII
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcactggtataccggaaattccatctacgacaccgtgctgacggcggctttcgcgttc
gcggcgttcgtgatcgtcggaggcttcttcgcacaaagctcgtatggtcgcttctccacc
acgaaactcgggctcaatctgaatccgaagctcggctggtggctgatggagataccggcg
acggtggtatttcttgtgtgctacctgaccgggcccgcccggttcgagccgacatcactg
gtgctcgccgggatctggctgctgcactacgccaaccgcggctggttcttcccactggcc
atccgccaggtacccggcaagcgcagtaccttcaacgtttcggttgtggtcatgggcatg
ctcgtgacatcgatgcacgggtacctcaacggcacccttttcagccacgacttcttcggg
cagtacaccagcgcctggctgcgcgatccgcgattcctactcggcctggtggtctatctg
tgcgggttcacactgctgctcagttccgagtcaatcgtccgtaacctgcgtgacaagaag
aaccctggcgcggccgaataccgcatcccgttcggcggcggattccggttcgtcaccagc
ccggcgtacctcggcgagctgatcgcctggtccggcttcgccctgctgacctgggcattg
cccggtgtggtgatcttgttgatcaccgccggcaacctcatcccccgggcgctggccacc
caccgctggtaccaggagaagttcatcgactaccccgccgaccggaaggcgctgatcccg
aagatcatctag

DBGET integrated database retrieval system