KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_3307Help
Entry
MASS_3307         CDS       T02682                                 

Definition
glycosyltransferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mabb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MASS_3307
Enzymes [BR:mabb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MASS_3307
Glycosyltransferases [BR:mabb01003]
 Polysaccharide
  Storage polysaccharide
   MASS_3307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3348481..3349725
Genome map
AA seq 414 aa AA seqDB search
MRILMVSWEYPPVVIGGLGRHVHHLSTELAAAGHDVVVLTRRPSGTDPSSHPTSDEISEG
VRVVAAAEDPHDFDFGTDMMAWTLAMGHAMVRAGLALGLKGSGDWRPDVVHAHDWLVAHP
AIALAEHFDVPLVSTLHATEAGRHSGWVSGRISRQVHSVEWWLARESDSLITCSASMLDE
VTQLFGPELPQVHVIRNGIDVTRWVFAPRPPADGTPPVLLFVGRLEYEKGIHDAIAALPK
IRRAHPGTVLAVAGDGTQQDWLLEQARKYKVVKSVQFLGTLDHSELLHWLHHADAILLPS
HYEPFGIVALEAAAAGTPLVTSTVGGLGEAVIDGETGMSFAPRDVAGIAEAVTRTLDDPA
AAAERAVAARARLTADFDWATVADETAQVYLAAKRREREPLGRSVIVERPLPDR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagaattctgatggtctcgtgggagtacccgccggtggtcatcggcggactgggccga
cacgtgcatcacctgtccaccgaattggccgccgccggacacgacgtggtggtgctgacc
cgccgcccctcgggcaccgacccgtcgagtcatccgacctccgacgaaatttccgaaggc
gtccgtgtggtcgctgccgccgaggacccccacgacttcgacttcggcaccgacatgatg
gcctggacgctcgccatgggacacgccatggtgcgggcgggattagccctgggcctcaag
ggatccggtgattggcgccccgacgtggtccacgcgcatgactggctggtcgcccacccc
gctatcgcgctggccgaacatttcgatgtcccgctggtgtccacgctgcacgccaccgag
gccggccgccacagcggctgggtgtctgggcgcatcagccggcaggtgcactcggtggaa
tggtggctggctcgcgaatcggactcgctgatcacctgctcggcctcgatgctcgacgag
gtgactcagctatttgggccggagctgccacaggtccacgtcatccgcaacggaatcgac
gtcactcgttgggtcttcgcgccccgaccacccgcagacggcactcctccggtgctgctt
tttgtggggcggctcgaatacgagaagggcatccacgacgcgatcgcggcgctgcccaag
atccgccgtgcgcaccccggaaccgtgctggcggtggccggcgatggtacacaacaggat
tggctgctggaacaggcgcgcaaatacaaggtcgtaaagtctgtccagttcctgggcacc
ctcgaccattcggagttgctgcactggttacatcatgccgacgccatcctactgcccagc
cactacgaaccgttcggcatcgtggcattggaggccgcggccgccggtactcccctggtg
acctcgaccgtcggcggtctcggtgaggcggtcatcgatggtgagacgggaatgtccttt
gcgccacgcgacgtggccggtattgccgaggcggtcactcgcacgctcgacgaccctgcc
gctgccgccgagcgggcggtagccgcacgggcgcggctcaccgcggacttcgactgggcc
actgtcgccgacgaaaccgcacaggtgtatttggcagccaagcgtcgcgagcgagagcca
ctgggccgcagcgtcatcgtcgagcgtcccctgccggaccggtaa

DBGET integrated database retrieval system