KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_3684Help
Entry
MASS_3684         CDS       T02682                                 

Gene name
deoA
Definition
pyrimidine-nucleoside phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mabb00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3694799..3696088)
Genome map
AA seq 429 aa AA seqDB search
MANTYIFDMPSIIATKRDGAELSPAAIDWLIGQYTSGDIGEEQVAALLMAIYLRGMNGAE
TAAWTAAILASGERLDLSGLSRPTVDKHSTGGVGDKISLPLVAVVAACGAAVPQLSGRGL
GHTGGTLDKLESVAGIRVDLSNDQIRQQLSDVGAVICAAGASLAPADRKLYALRDITGTV
ESIPLIAGSIMSKKLAEGTAALVLDVKVGAGAFMKSEQRARELASAMVDLGTAHGVATSA
LLTAMDTPLGATAGNAVEVQESLDVLAGGGPEDVVALTVTLAREMLAAAGIDGKDPAATL
TDGTAMDVFRAMIHAQGGDLAVPLPLGRCQETVLAPVGGVMRRIDAMPVGIAAWRLGAGR
SRPGEVVQHGAGVRIHRRPGDAVVAGEPLFTLYTDTQERLPAALDALEGGWEIGAAPTAT
PLIIDRLPV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatacatacatcttcgatatgccgtcgatcatcgccaccaagcgggacggcgcg
gagctgagcccggccgccatcgattggctgatcggccagtacaccagcggcgacatcggt
gaggaacaggtcgcggccctgctgatggcgatttatctgcgcggcatgaacggcgccgag
acggcggcgtggacagcggcgatcctggcgtccggcgagcgactggacctgtccgggttg
tcccggccgaccgtcgacaagcactccaccggcggagtgggcgacaagatcagcttgccg
ctggtcgccgtcgtcgcggcgtgcggagcggcagttccacagctttccggacgtggcctc
ggacacaccggcggcactctcgacaagctcgaatccgttgcgggtatccgtgtcgatctc
tccaatgaccagatacgtcagcagctttccgacgtgggggcggtgatctgcgcggccggg
gcgtcattggcgcccgccgaccgaaagctctacgcgctgcgggatatcaccggcaccgtc
gagtcgattccgctcatcgccgggtcgatcatgagtaagaagctggcggaaggtaccgcc
gcgctggttctggacgtcaaggtcggcgcgggcgcgttcatgaaatccgaacagcgcgct
cgtgaattggcctcggcgatggtcgatctgggtaccgcgcacggggtggccaccagcgcc
ctgctgaccgcgatggacaccccattgggggccaccgcgggaaacgcggtcgaggtgcag
gaatcgctcgacgtgctggcggggggagggccggaggatgttgtcgcgctcaccgtgacg
ctggcccgcgagatgctcgcggcggccgggatcgacggcaaggatccggccgcgacgctg
accgacggcaccgccatggacgtgttccgcgcgatgatccacgcgcagggtggtgacctc
gccgtgccgctaccgctggggcggtgtcaggagaccgtgctggccccggtcggtggtgtc
atgcgccgtatcgacgcgatgcctgtcgggatcgcggcctggcgcctaggtgccggacgc
agccgcccgggggaggtggtgcagcacggtgccggggtgcgcattcaccgcagaccgggc
gacgcggtggtagccggagaaccactgttcactctgtataccgacacccaggagcgattg
cccgccgcgctcgacgcgctggaaggtgggtgggagatcggtgcggcaccgaccgctacc
cccctcatcatcgatagacttccggtgtga

DBGET integrated database retrieval system