KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_3761Help
Entry
MASS_3761         CDS       T02682                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mabb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MASS_3761
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MASS_3761
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MASS_3761
Enzymes [BR:mabb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MASS_3761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3772037..3773581
Genome map
AA seq 514 aa AA seqDB search
MFACCPKGGGMTAFPRRTVLRAALLGLAAAPVAACGPALVTTRPRLTHGVASGFPRTDGA
VIWARSDRPASLIVETAATESFSDARRFTGPLLTPDADGTGRIRLTGLPADSEVHYRVTL
DADGALSEPATGVFRTAPATARDVRLIWSGDVAGQGFGINPDIGGMTVFRTMAERNPHFF
IHSGDTVYADVPIPETLPLPDGRIWRNEVSEAKSAVAQTLDQYRGQHAYNLTDANYRYFN
AHVPQLVQWDDHEVINNWYPGEVLDNDKYTEKRVDILAQHGHRAFHEWQPLEAREAVDGR
VYQRVSYGPLLDVFLLDMRSYKDPNSPNRQQHGTILGARQAGWLVNEMASSTAVWKVVAN
DLPLALAVPDGKTDFEAVANGDNGLPLGRETELAHILSQLKARKVRNVIWLTADVHYTAA
HEYSPTRAAFTDFDPFWEFVSGPLNAGAGKESTLDGTFGPRADFVHAAPPGKQSPLDGYQ
HFGQVDIDGDSGDLTVTLCDAAGTALYTRTLARS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgcctgctgccctaaaggtggtgggatgacagcttttccgcgccgcacagtgctg
cgggccgctctgctcgggctcgcggcggcgccggtggccgcatgtgggccggcgctcgtg
acaacgcgcccgcggttgacccacggagtcgcaagcggattcccgcgtaccgacggcgcg
gtgatctgggcccgctcggatcgacccgcctccctgatcgtcgaaaccgctgccaccgaa
agtttttcggacgcaagacgcttcaccggcccgctgcttactccggacgcggacggcacc
ggccgaatccgcctcaccggcctgcccgcggattcggaggtgcactaccgggtgacgctt
gatgcggacggggcgctcagcgagcccgccaccggcgtcttccgaaccgcgccggcgacg
gcccgcgacgtccggctgatctggtccggggatgtggcggggcaggggttcggcatcaat
cccgacatcggcggaatgacggtcttccgcaccatggccgagcgaaatccccacttcttc
atccacagtggcgacacggtgtacgcggatgtcccgattcccgagaccctgcccctgccc
gacggacggatctggcgcaacgaggtatccgaggcgaaaagcgctgtcgcgcagaccctt
gaccagtatcgcggacaacacgcctacaacctcaccgacgccaactaccggtacttcaat
gcccacgtgcctcagctcgtgcagtgggatgaccacgaggtgatcaacaactggtacccc
ggcgaggtgctcgacaacgacaagtacaccgaaaagcgggtcgacatactcgcgcagcac
ggacatcgggcattccatgaatggcaaccgctggaagcccgcgaggccgtggacgggcgt
gtgtaccaaagagtctcgtacggcccactactggatgtgttcctgctcgacatgcggagc
tacaaggatcccaactcccccaaccgtcagcaacacggcaccatcctgggtgcccgccag
gccggatggctcgtcaacgagatggcctcatccacggccgtgtggaaggtcgtggccaat
gacctgcccctggcactggcggtaccggacggaaaaactgatttcgaggccgttgccaac
ggcgacaacggcttacctctcggacgggaaaccgaactggcgcatattctctcgcaactc
aaggcacgaaaggtgcgcaacgtgatatggctgacagccgacgtgcactacaccgcggca
cacgaatactcacccacccgcgccgccttcaccgacttcgacccgttctgggagttcgtg
tcgggcccgctgaacgcgggtgccgggaaagagtcgacactcgacggaaccttcggtccc
cgtgccgatttcgtccatgcggcaccgcccggcaagcagtcaccactggacggctatcaa
cacttcgggcaggtcgacatcgacggcgacagcggcgacctgacggtcacactgtgtgac
gcggcgggcacggccctgtacacccgcaccctggcacggagttag

DBGET integrated database retrieval system