KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_4336Help
Entry
MASS_4336         CDS       T02682                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Pathway
mabb00220  Arginine biosynthesis
mabb00250  Alanine, aspartate and glutamate metabolism
mabb00290  Valine, leucine and isoleucine biosynthesis
mabb01100  Metabolic pathways
mabb01110  Biosynthesis of secondary metabolites
mabb01130  Biosynthesis of antibiotics
mabb01210  2-Oxocarboxylic acid metabolism
mabb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mabb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MASS_4336
   00290 Valine, leucine and isoleucine biosynthesis
    MASS_4336
   00220 Arginine biosynthesis
    MASS_4336
Enzymes [BR:mabb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MASS_4336
    2.6.1.66  valine---pyruvate transaminase
     MASS_4336
Amino acid related enzymes [BR:mabb01007]
 Aminotransferase (transaminase)
  Class I
   MASS_4336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGM30938
UniProt: R4UJB4
Position
4354208..4355491
Genome map
AA seq 427 aa AA seqDB search
MSTDNLPIDVPPRVPGLSPRQHQRVFAQSTKLQDVLYEIRGPVHAHAARLEAEGHRILKL
NIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGILPARRAVVTRYELVDGFPYLDVDD
VFLGNGVSELITMTTQALLDNGDQVLIPAPDYPLWTAATSLAGGTAVHYLCDETNGWMPD
IEDLESKITERTKALVIINPNNPTGAVYSREILTKMVELARKHQLLLLADEIYDKILYDD
AEHISVASLAPDLLCFTFNGLSKAYRVAGYRSAWLAITGPKDHAASLLEGVNLLANMRLC
PNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKPQGALYAFPR
LDPEVHHIHDDDQLVLDLLLNEKILLTQGTGFNWPEPDHLRIVTLPWARDLAVAIERLGN
FLASYRQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgataacttgccgattgacgtgcccccgcgcgtgcccggcctttcgccgcgg
cagcatcagcgggtcttcgcgcagtccaccaagctacaagacgtcctgtacgaaatcagg
ggtccggtacacgcacacgccgcccggctcgaggctgagggtcatcgcatcctcaagctc
aacatcggcaaccctgcgccgttcggattcgaggcgcccgatgtcatcatgcgcgacatc
atccaggcgctcccctacgcacagggctactccgactccaagggcatcctgcccgcccgg
cgcgcggtggtcacccgctacgaactggtcgacgggttcccgtacctggatgtggacgac
gtcttcctgggcaatggggtatccgagctgatcaccatgaccacccaggcgctgctcgac
aacggcgaccaggtgctcatcccggcgcccgactatccgctgtggaccgccgcgacctca
cttgccggcggcaccgcggtgcattacctgtgcgacgagaccaacggctggatgcccgat
atcgaggatctggaatccaagatcaccgagcgcaccaaggccctcgtcatcatcaacccg
aacaacccgaccggcgcggtatacagccgcgagatcctcacgaagatggtcgaactggcc
cgcaagcatcagttactgctgctggccgacgagatctacgacaagatcctgtacgacgac
gccgagcacatcagcgtcgcgtcacttgccccggatctgttgtgtttcaccttcaatggc
ctgtccaaggcatatcgagtggctggctaccggtcagcatggcttgccatcaccgggccc
aaggaccacgccgccagcctgctggaaggcgtgaacctgctggccaatatgcgactgtgc
ccgaatgttcctgcccagcatgcgattcaggtggccctcggtggacaccagagcatcgag
gatctggtgttaccgggtggtcgcctgctggagcagcgcgatgtcgcctggacaaagctc
aacgagatccccggtgtctcctgcgtcaagccgcagggtgcgctctacgcgttcccgcgc
ctggaccccgaggtgcaccatatccacgacgacgaccagctcgtcctggatctgctgctc
aacgagaagatcctgctgacgcagggcaccggcttcaattggcctgagcccgaccatctt
cggatcgtcacgttgccatgggcccgcgaccttgccgtcgccatcgagcgcctgggcaac
ttcctggcgagctaccgccagtag

DBGET integrated database retrieval system