KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_4420Help
Entry
MASS_4420         CDS       T02682                                 

Definition
hypothetical protein
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mabb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MASS_4420
  Amino acid metabolism
   00380 Tryptophan metabolism
    MASS_4420
Enzymes [BR:mabb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MASS_4420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4435931..4437385
Genome map
AA seq 484 aa AA seqDB search
MTDNNFTTTGAGRPIRSDELSLTLGPDGPVLMQDFYLIEALADFNRERVAERQPHAKGAG
AFGRFEVTNDVSAYTRAAVFQPGTTTEAFVRVAGNASERGSADTLRDTRGFSVKFYTSEG
NYDIVGNNVPMFFIRDAIKFPNLIRASKRRADNDCHDHNMVWDFWTLSPESAHLVTLVMG
DRGIPKTFRHMNGYGLHTFSWVNDAGEIVWVKYHFKSDQGVESLTQEEADRLAGTDPDCN
MRDLHEAIARGDHPSWSLKVQIMPFEDAKTYRINPFDVTKVWPHADYPLIDVGTLTLDRN
ITDHHTEVEQATFTPASLVPGIGLSPDRLLLGRSFAYADAHRHRVGVNHNQIPVNAPKVG
VRSYTKDGAMRFYNRTDPVYVPNSVGGPHADPARAAEVRWAADGHMVRAAQTLRPDDDDW
SQARDLLLNVMNDEERERLVHNVVLHVSDGVKEPILSRVFEYWRNIDIDTGDKIERGVRA
ATNT
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaacaacttcaccaccactggggccggtcgcccgattcgcagcgatgagttg
tccttgaccttgggacccgacgggcctgtgttgatgcaagacttctacctgatcgaggcg
ctcgccgacttcaaccgggaacgggttgccgaacgtcagccgcatgccaagggggctggc
gcctttggccgcttcgaagtgaccaatgatgtaagcgcctatacccgagcggcggtgttt
cagcccggcaccaccaccgaggcattcgttcgggtagccggcaatgccagcgagcgcggc
agcgccgataccctgcgcgacacccgcgggttttcggtcaagttctatacctccgaaggt
aactacgacatcgtcggcaacaacgtccccatgttcttcatcagagatgcgatcaaattc
cccaacctgatccgtgcttccaagcgacgcgccgacaacgactgccatgatcacaacatg
gtctgggatttttggacgttgtcgcccgaatccgcccacctggtgacactggtaatggga
gatagaggtattcccaagacatttcgccacatgaacggctatggcctacacacgttcagc
tgggtcaatgatgccggagagatagtctgggtcaagtaccacttcaagtccgaccaaggc
gtggaaagtttgacgcaggaagaagccgaccgcctggccgggaccgaccctgactgcaac
atgcgagacctccacgaagctatcgcgcggggcgaccatccgagctggtcgctaaaggtc
cagatcatgccgttcgaagacgcaaagacctaccgtatcaacccatttgatgtaaccaag
gtgtggccgcatgccgactatccgctgatcgacgtcggcacgctgacgttggaccgcaac
atcaccgatcaccacaccgaagtggagcaagcgacgttcacgcccgccagcctggtgccg
ggaatcggcctgagcccagacaggctcctactagggcgtagctttgcctatgccgacgcc
caccggcatcgtgttggagtcaaccacaatcaaatcccggtcaatgccccaaaggtcggg
gttcgcagttacaccaaggacggcgctatgcgcttctacaaccgtaccgatccggtgtac
gtacccaactcagtcgggggaccacatgcggatcccgctcgggccgccgaagttcgttgg
gccgccgatggacatatggtacgcgcggcgcagacactgcgccccgacgatgacgactgg
agccaggctcgagacctgctcctgaacgtgatgaacgatgaagagcgggaacgcctggtg
cacaacgtagttctacacgtgagcgatggcgtgaaagagccaatcctttcccgagttttc
gagtactggagaaacatcgatattgacaccggcgacaaaatcgagcgcggcgttcgcgcc
gcgacaaatacgtag

DBGET integrated database retrieval system