KEGG   Mycobacterium abscessus subsp. bolletii 50594: MASS_4849Help
Entry
MASS_4849         CDS       T02682                                 

Definition
cellulase CelA
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mabb  Mycobacterium abscessus subsp. bolletii 50594
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mabb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MASS_4849
Enzymes [BR:mabb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MASS_4849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4894610..4895566)
Genome map
AA seq 318 aa AA seqDB search
MISSAVGAVARWIAPCLAVLSLGIFLGPVAEADNPLDGQGFYVNPNSAAMRAAQGAGSPE
LTSIANTPQAYWMDNVSSPSVDAKYISAAQASGATPVLALYAIPHRDCGSFAAGGFGSAD
AYKGWIDGVAAAIGAGPAVVILEPDALAMADCLSGAQRQERFDLMRYAVDTLTRNPATAL
YIDGGHSRWVSADVMAARLNEVGVSKARGFSLNTANFFTTDEEIGYGDAISGMTNGAHYV
IDTSRNGAGPTSDALYWCNPSGRALGTPPTTATASPNADAYLWVKRPGESDGSCDRGDPR
AGTFVNQFAIDLARNAGR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcctcagctgttggtgctgttgcgcgatggattgccccctgtttggccgtgttg
agcctgggtattttcttgggcccggtggcagaggcggacaacccgctggatggccaaggg
ttctacgtcaatcccaactcggcagccatgcgtgccgcacagggcgcgggcagccccgag
ctgacgtccatcgccaatacaccacaggcgtattggatggacaacgtctcatccccgagc
gtggatgcgaagtacatcagcgcggcccaggcctccggtgccacacccgtgttggctctc
tacgccatcccgcaccgcgactgcggcagcttcgccgccgggggcttcggatcggccgac
gcatataaaggatggatcgacggtgtggccgccgccatcggggccgggcccgcggtggtc
attctcgagcccgacgcgctcgcgatggctgattgcctctcgggggcccagcgccaagag
cgctttgatctgatgcgttatgccgtcgacacactgacccggaatccggccaccgccctc
tacatcgacggtggccactcacgttgggtgagcgccgatgtcatggccgcccggctcaat
gaggtaggcgtcagcaaggcgcggggctttagcctcaacaccgcgaacttcttcaccacc
gacgaggagatcggttacggcgatgcgatttcggggatgacgaacggtgcgcattacgtg
atcgatacctcgcgcaatggcgccggccccacttccgatgcgctctattggtgcaacccg
agtggtcgtgcgctcggtaccccgcccaccaccgctaccgcgagtccgaatgccgatgcc
tacctgtgggttaagcgtcccggtgagtccgatggttcgtgcgaccgtggagacccgagg
gcaggcaccttcgtgaatcagttcgcgatcgatctggcgcgtaacgcaggccggtag

DBGET integrated database retrieval system