KEGG   Mycobacterium abscessus subsp. bolletii CCUG 48898 = JCM 15300: MMASJCM_0437Help
Entry
MMASJCM_0437      CDS       T03694                                 

Definition
(GenBank) probable acetyl-CoA acetyltransferase FadA5
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mabl  Mycobacterium abscessus subsp. bolletii CCUG 48898 = JCM 15300
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mabl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMASJCM_0437
   00630 Glyoxylate and dicarboxylate metabolism
    MMASJCM_0437
   00640 Propanoate metabolism
    MMASJCM_0437
   00650 Butanoate metabolism
    MMASJCM_0437
  Lipid metabolism
   00071 Fatty acid degradation
    MMASJCM_0437
   00072 Synthesis and degradation of ketone bodies
    MMASJCM_0437
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MMASJCM_0437
   00310 Lysine degradation
    MMASJCM_0437
   00380 Tryptophan metabolism
    MMASJCM_0437
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MMASJCM_0437
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MMASJCM_0437
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MMASJCM_0437
Enzymes [BR:mabl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MMASJCM_0437
Exosome [BR:mabl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MMASJCM_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
441745..442500
Genome map
AA seq 251 aa AA seqDB search
MGNPVIVEATRSAIGKRGGWLAGLHPAELLGSIQRSVIARAGLDPHEVEQVIGGCVTQFG
EQGGHITRQAWLHAGLPEATGATTIDCQCGSAQQANHLIAGLIYSGAIDTGIACGIESMS
RVPLGANVGGTGIPRPDSWDIDMPNQFEAAERIAKRRGITRADVDGLGVRSQALAAQAWA
EGRFDREITPLDAPQVDKEGNPTGETKTVNRDQGLRETTLESLGNLKPVIAKVFTPQVRP
RRFPTAPRRCC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatccggtcatcgtcgaagcaacgcgcagcgccatcggcaaacgcggtggatgg
ctcgcggggctgcatcccgccgagctgctgggcagcatccaaaggtcggtgatcgcacgc
gccggtctcgacccgcacgaggtcgagcaggtcatcggcggctgcgtgacccaattcggc
gagcagggcggacacatcacacgacaggcatggctgcacgccgggctgcccgaagccacc
ggcgccaccaccatcgactgccagtgcggcagcgcgcagcaggccaaccatctcatcgcc
ggcctgatctactccggcgcgatcgataccggcatcgcctgcggtatcgagtccatgagc
cgagtgccccttggcgccaacgtcggcggtaccggcattccgcggcccgactcctgggat
atcgacatgcccaatcagttcgaggccgccgagcgcatcgccaagcgccgcggcatcacc
cgcgccgacgtcgacgggctgggggtgcgttcgcaggcgctcgccgcccaggcctgggcc
gaggggcgattcgaccgagagatcacaccgctcgatgccccgcaggtggacaaggaaggc
aaccccaccggcgagaccaagaccgtcaaccgcgaccagggtctgcgcgagaccactctg
gaatcactgggcaacctgaaacccgttatcgcgaaggtattcacaccgcaggtacgtcct
cgcagatttccgacggcgccgcggcggtgctgctga

DBGET integrated database retrieval system