KEGG   Methanosarcina acetivorans: MA0031Help
Entry
MA0031            CDS       T00080                                 

Gene name
porB
Definition
pyruvate synthase, subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mac  Methanosarcina acetivorans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MA0031 (porB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MA0031 (porB)
   00020 Citrate cycle (TCA cycle)
    MA0031 (porB)
   00620 Pyruvate metabolism
    MA0031 (porB)
   00640 Propanoate metabolism
    MA0031 (porB)
   00650 Butanoate metabolism
    MA0031 (porB)
  Energy metabolism
   00680 Methane metabolism
    MA0031 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MA0031 (porB)
Enzymes [BR:mac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MA0031 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(41309..42199)
Genome map
AA seq 296 aa AA seqDB search
MSKPAPKTYLSPGHRGCAGCCDALASKFMLMGAGPDTIVINPTGCLEVMTTPFPESAWQV
PWIHSLFENGGAVASGVEAALKALGRKGNTRVIGVGGDGSTMDIGIRSLSGAFERGHDIT
YVCVDNEAYMNTGIQRSSGTPFDASTTTSPAGKVSFGNPRPKKDMPAIMAAHGSPYVATT
SIGFPRDMMRKVKKATEIVGPTYIHSHAPCPTGWGFDGSKTIEIAKLAVETCLWPMYEME
NGEITQVRKVKDSRPVEEYLRAQKRFKHLFTMEGGEEEIAKIQAAADWNIKHYGLQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacccgcaccaaaaacttacctctctccggggcacaggggctgtgcaggctgc
tgtgacgcccttgcctcaaaattcatgctcatgggtgcaggcccggacactatagtgatt
aaccctacaggctgcctggaagttatgaccacacccttcccggaatctgcctggcaggtc
ccctggatccactccctctttgaaaacggaggtgcagtagcatcaggcgtcgaagctgct
ttaaaagccctcggcaggaaaggaaacaccagggtcatcggagtcggcggtgacggctcg
actatggacatagggattagatccctttcaggtgccttcgaaaggggccacgacattacc
tacgtctgtgtagacaatgaagcctacatgaacaccgggatccagagaagttcaggaacc
cccttcgacgcttccacaacaacaagccccgcaggtaaagtttccttcggaaacccgcgc
cccaagaaagacatgcccgccatcatggcagctcacggctccccgtacgttgccacaact
tcaatcggtttcccgcgggacatgatgagaaaggtcaagaaagctaccgaaattgtgggc
cctacctacatccactcccacgcgccctgcccaaccggttggggcttcgatggctccaag
accatcgaaatagcaaaactcgcagtcgagacctgcctctggcccatgtatgaaatggaa
aacggcgagatcacccaggtcagaaaagtcaaggattcgagaccagtcgaggaatacctc
cgcgctcagaagcggttcaaacaccttttcaccatggaaggcggcgaagaagaaatcgca
aagatccaggctgctgcagactggaacataaaacactacggacttcagtaa

DBGET integrated database retrieval system