KEGG   Methanosarcina acetivorans: MA0033Help
Entry
MA0033            CDS       T00080                                 

Gene name
porD
Definition
pyruvate synthase, subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mac  Methanosarcina acetivorans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MA0033 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MA0033 (porD)
   00020 Citrate cycle (TCA cycle)
    MA0033 (porD)
   00620 Pyruvate metabolism
    MA0033 (porD)
   00640 Propanoate metabolism
    MA0033 (porD)
   00650 Butanoate metabolism
    MA0033 (porD)
  Energy metabolism
   00680 Methane metabolism
    MA0033 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MA0033 (porD)
Enzymes [BR:mac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MA0033 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(43407..43667)
Genome map
AA seq 86 aa AA seqDB search
MKVPIGGTCEPGSTLANKTGGWRNFRPVYIYEKCTKCGICQIVCPDMSVLPREDGFFEYN
YDYCKGCGICANECPADAIEMILEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcccaattggaggaacttgtgaaccgggttcaaccctagcaaataaaaccgga
ggctggagaaacttccgtcctgtttatatttatgaaaaatgcaccaaatgcggaatctgc
cagattgtgtgcccggatatgtcagttcttcccagagaagatggctttttcgagtacaac
tatgattactgcaagggatgcggcatctgtgcaaacgaatgccctgcagatgcaattgaa
atgattctggaggagaaataa

DBGET integrated database retrieval system