KEGG   Methanosarcina acetivorans: MA0034Help
Entry
MA0034            CDS       T00080                                 

Gene name
porG
Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mac  Methanosarcina acetivorans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MA0034 (porG)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MA0034 (porG)
   00020 Citrate cycle (TCA cycle)
    MA0034 (porG)
   00620 Pyruvate metabolism
    MA0034 (porG)
   00640 Propanoate metabolism
    MA0034 (porG)
   00650 Butanoate metabolism
    MA0034 (porG)
  Energy metabolism
   00680 Methane metabolism
    MA0034 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MA0034 (porG)
Enzymes [BR:mac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MA0034 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(43664..44212)
Genome map
AA seq 182 aa AA seqDB search
MKEIRIHGRGGQGSVTAAEMLSVAAFEDGKFSQAFPAFGVERRGAPVQAFTRLSDSPIRL
RSQIYTPDYVIVQDATLLETVNVASGIKDDGIIIINTKEKPEDLKLDTKARVMTVDATKV
AMDIIGLPIVNTVLLGAFAGATGEINVESIKKAVKDRFSGKVADKNAQAIQKAYELIRGE
EA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaatcagaatacacggtcgaggaggccagggttctgttactgcagctgaaatg
ctttccgttgcagcttttgaagacggaaagttcagccaggccttccctgcttttggggta
gagcgcagaggtgctcctgtgcaggcattcacgaggctcagtgacagtccgatcaggctc
cgaagccagatatacacaccagattacgtgatcgtccaggatgccaccctgctcgaaaca
gtcaatgttgcaagcgggataaaagacgatggcattatcattatcaacacaaaagaaaaa
cccgaagacctcaaacttgatacaaaagcaagagtcatgaccgtggacgccacaaaggtg
gcaatggacattataggtcttcctattgtgaacaccgtcctccttggagcttttgcaggt
gcaaccggagaaatcaatgtggaatccattaaaaaagccgtaaaggaccgcttttccggc
aaagtagccgataagaacgctcaggctatccagaaagcttatgaacttatcaggggggaa
gaagcatga

DBGET integrated database retrieval system