KEGG   Methanosarcina acetivorans: MA0263Help
Entry
MA0263            CDS       T00080                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mac  Methanosarcina acetivorans
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mac00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
320466..321026
Genome map
AA seq 186 aa AA seqDB search
MWQEMAKYGRKLVGHGLVESNFGNISVRAGDRMLITRSGTALDEITGDNVVEVEIQDTSS
LDIIASSETVVHREIYTKTSALAIIHAHCPYSVVESLLAGPAGTIVPVDSEGQYFLGNIP
VVSGGIGSLELAENLAGELSGHRGAVVFSHGTFAIGRTLGEAYIVTTQLEHSCRIKYLYE
LAAVKK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggaaatggcaaaatacgggcgcaagctggtgggacacgggcttgtggaatca
aacttcgggaatatcagtgtcagggccggagaccggatgcttattacccggagtgggact
gctcttgatgaaatcaccggggataacgttgttgaggtggagattcaggatacctcgtct
ctggatataattgcgtcttccgaaacggtagtgcacagggagatctacacgaaaacttct
gctctggcaataatccacgctcactgcccttattcggtggttgagtccctgcttgccggt
cctgcgggaacgattgttcctgtggacagtgagggtcagtatttcctcgggaatatcccg
gtggtaagcggcggaatcgggagcctggaacttgccgaaaaccttgcaggtgagctttca
ggacacagaggggctgtggttttcagccacggaacttttgccatcggaaggactctcgga
gaagcttatattgtgaccacgcagcttgagcactcctgcagaataaagtacctgtatgag
cttgcagccgtaaaaaagtga

DBGET integrated database retrieval system