KEGG   Methanosarcina acetivorans: MA0417Help
Entry
MA0417            CDS       T00080                                 

Gene name
fdh
Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mac  Methanosarcina acetivorans
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mac01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mac00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:mac00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
497558..498742
Genome map
AA seq 394 aa AA seqDB search
MKAVVYKGPRNVDVEEVKKPEIEKPTDVIIKVTSSGICGSDLHLYDGHGPDGLGTILGHE
PMGVVEEVGDAVELVKPGDRVVIPFNVACGSCLNCIRGLTNMCLTMNPDAAIANYGYPGA
GPYAGGQAEYLRVPYGDWACLKLPGEPGDEFEDDFVMLADIFPTAYYAAELAKVKTGKTV
AVFGAGPVGLLAAYSSMLMGASEVYVVDKSDKRLKLAESIGAVPINFTDGDPVEMIMQIR
QNNKNLMSSLRPGEEKVLGVDCAIDAVGYQALDRNNSEEFKPNQVLMDIARIIAPGGSIG
VIGVYSPDPAGKDENEKQGYLTLPWAELWFKGVSIGTGPTPVKQMHGFLRNLIFNGKAKP
SFIVSDRISIDEAPEAYKQFDKRDDVVKPIIKFH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtggtatataaaggaccaagaaatgtagatgttgaagaagttaaaaaacca
gaaatagagaagccaactgacgtaattataaaagtgacaagtagtggaatctgtggaagt
gatttacatctatatgatggccatggtcctgacggattaggaacaattttaggacatgaa
ccaatgggagttgttgaagaggttggagatgcagttgagctagttaaacctggtgatagg
gtagtaataccatttaatgttgcatgtggatcttgtttgaactgtatcagaggtttaacc
aatatgtgtcttaccatgaatccagacgcagctatagcaaactatggatatcctggagcg
ggaccatatgctggtggacaagctgagtacctgagagttccttatggagattgggcttgc
ttaaaattacccggtgagccgggggatgaatttgaagatgattttgtgatgcttgcagac
atatttccaactgcatattatgcagcagagttagctaaagtaaaaactgggaaaacggta
gctgtttttggcgccgggcctgtgggtttacttgcagcgtacagttcaatgttaatgggt
gcaagtgaagtctacgttgttgataaatctgataaacgtttaaaacttgctgaatcaatt
ggtgcagttccaattaactttacagatggtgatcccgttgagatgataatgcaaatccgt
caaaataacaaaaatttaatgagttctctaaggcctggagaagaaaaggttttaggtgtg
gattgtgcaattgatgcagtgggttatcaagcacttgatagaaataattctgaagaattt
aagccaaaccaagttttaatggacatcgcaagaattatagccccagggggcagcattgga
gtaattggtgtttatagtccagatcctgccggtaaggatgagaatgagaaacaaggatat
ttaacgcttccgtgggctgaattatggttcaaaggagtatctataggtactggaccgaca
cctgttaaacaaatgcacgggtttttaagaaatttgatattcaatggtaaagcaaaacca
agcttcatagtatctgaccgtatcagcattgatgaagctcctgaagcatataagcaattt
gataagagggatgatgtagttaagcctataatcaaattccattaa

DBGET integrated database retrieval system