KEGG   Methanosarcina acetivorans: MA0417Help
Entry
MA0417            CDS       T00080                                 

Gene name
fdh
Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mac  Methanosarcina acetivorans
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MA0417 (fdh)
  Energy metabolism
   00680 Methane metabolism
    MA0417 (fdh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MA0417 (fdh)
Enzymes [BR:mac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     MA0417 (fdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
497558..498742
Genome map
AA seq 394 aa AA seqDB search
MKAVVYKGPRNVDVEEVKKPEIEKPTDVIIKVTSSGICGSDLHLYDGHGPDGLGTILGHE
PMGVVEEVGDAVELVKPGDRVVIPFNVACGSCLNCIRGLTNMCLTMNPDAAIANYGYPGA
GPYAGGQAEYLRVPYGDWACLKLPGEPGDEFEDDFVMLADIFPTAYYAAELAKVKTGKTV
AVFGAGPVGLLAAYSSMLMGASEVYVVDKSDKRLKLAESIGAVPINFTDGDPVEMIMQIR
QNNKNLMSSLRPGEEKVLGVDCAIDAVGYQALDRNNSEEFKPNQVLMDIARIIAPGGSIG
VIGVYSPDPAGKDENEKQGYLTLPWAELWFKGVSIGTGPTPVKQMHGFLRNLIFNGKAKP
SFIVSDRISIDEAPEAYKQFDKRDDVVKPIIKFH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtggtatataaaggaccaagaaatgtagatgttgaagaagttaaaaaacca
gaaatagagaagccaactgacgtaattataaaagtgacaagtagtggaatctgtggaagt
gatttacatctatatgatggccatggtcctgacggattaggaacaattttaggacatgaa
ccaatgggagttgttgaagaggttggagatgcagttgagctagttaaacctggtgatagg
gtagtaataccatttaatgttgcatgtggatcttgtttgaactgtatcagaggtttaacc
aatatgtgtcttaccatgaatccagacgcagctatagcaaactatggatatcctggagcg
ggaccatatgctggtggacaagctgagtacctgagagttccttatggagattgggcttgc
ttaaaattacccggtgagccgggggatgaatttgaagatgattttgtgatgcttgcagac
atatttccaactgcatattatgcagcagagttagctaaagtaaaaactgggaaaacggta
gctgtttttggcgccgggcctgtgggtttacttgcagcgtacagttcaatgttaatgggt
gcaagtgaagtctacgttgttgataaatctgataaacgtttaaaacttgctgaatcaatt
ggtgcagttccaattaactttacagatggtgatcccgttgagatgataatgcaaatccgt
caaaataacaaaaatttaatgagttctctaaggcctggagaagaaaaggttttaggtgtg
gattgtgcaattgatgcagtgggttatcaagcacttgatagaaataattctgaagaattt
aagccaaaccaagttttaatggacatcgcaagaattatagccccagggggcagcattgga
gtaattggtgtttatagtccagatcctgccggtaaggatgagaatgagaaacaaggatat
ttaacgcttccgtgggctgaattatggttcaaaggagtatctataggtactggaccgaca
cctgttaaacaaatgcacgggtttttaagaaatttgatattcaatggtaaagcaaaacca
agcttcatagtatctgaccgtatcagcattgatgaagctcctgaagcatataagcaattt
gataagagggatgatgtagttaagcctataatcaaattccattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system