KEGG   Methanosarcina acetivorans: MA0543Help
Entry
MA0543            CDS       T00080                                 

Gene name
pcm-2
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mac  Methanosarcina acetivorans
Brite
Enzymes [BR:mac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MA0543 (pcm-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(633604..634320)
Genome map
AA seq 238 aa AA seqDB search
MVLVNAISEKDYIKDSRRRKKEEKEFEKLRKLLVEGLEDIVRDKKVLKAMFRVPRHRFVP
EYEQRAAYTDRPLEIGHGQTISTPHTVALMCEILELSEGHKVLEIGTGSGYNAAVMAELV
GKTGHIYSVERIEPLVNFARKNLEQMGYDNVTVLLENGSMGYPRYAPYDRIAVTCAAPTI
PKALLEQLKPGGIMVIPVGDYSQELIRVKKDSNGNIYKKRKGEVIFVPMLGRHGFPRS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
attgttctggtcaacgcgatttccgaaaaggactatatcaaggatagcaggagaagaaaa
aaagaagaaaaagaattcgaaaagcttcgcaagctccttgtagaagggcttgaagatatc
gtacgggataaaaaagtgctcaaggccatgttccgtgttcccagacacaggtttgttccg
gaatatgagcaaagggcagcttatacggacagacctctagaaatcggtcatgggcaaaca
atatccacccctcatacggttgcgcttatgtgtgaaatcctggagctgtctgaagggcat
aaagtcctggaaattggaaccgggtccggatataacgctgcagtaatggcagagctcgta
ggaaaaaccggacatatatacagtgtggaacgcatagaacctcttgtaaattttgcaaga
aagaacctggagcaaatggggtacgataatgttacagtattacttgagaatgggtcaatg
ggttatcccagatatgcaccttatgacaggatcgctgtaacatgcgcggcccccaccatc
cccaaggctctgttggaacagttaaagcctggaggaataatggtaattcctgtaggagat
tattcccaggaacttatcagggttaaaaaagatagcaatggcaacatatataagaaaaga
aaaggtgaagttatcttcgtgcctatgcttggaagacatggcttcccaagaagttga

DBGET integrated database retrieval system