KEGG   Methanosarcina acetivorans: MA0599Help
Entry
MA0599            CDS       T00080                                 

Gene name
rpoK
Definition
DNA-directed RNA polymerase subunit K
Orthology
K03055  
DNA-directed RNA polymerase subunit K [EC:2.7.7.6]
Organism
mac  Methanosarcina acetivorans
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MA0599 (rpoK)
   00240 Pyrimidine metabolism
    MA0599 (rpoK)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    MA0599 (rpoK)
Enzymes [BR:mac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     MA0599 (rpoK)
Transcription machinery [BR:mac03021]
 Prokaryotic type
  Archaeal type
   RNA polymerase
    Core subunits
     MA0599 (rpoK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
702924..703106
Genome map
AA seq 60 aa AA seqDB search
MVKEKYTRFERARIVGARALQIAMGAPVLVDDDGRLDPLGVAIAELKAEIIPITVKRKKS
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
ttggtcaaggaaaagtatacccggttcgagcgtgcacgaattgtaggtgcaagagcattg
cagatagcaatgggggctcctgtcctggttgatgatgacgggcggctggaccccctgggt
gtagccattgcagagttgaaggccgaaattattcctataacggtcaaacgtaagaaaagc
tga

DBGET integrated database retrieval system