KEGG   Methanosarcina acetivorans: MA0599Help
Entry
MA0599            CDS       T00080                                 

Gene name
rpoK
Definition
DNA-directed RNA polymerase subunit K
Orthology
K03055  
DNA-directed RNA polymerase subunit K [EC:2.7.7.6]
Organism
mac  Methanosarcina acetivorans
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mac00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mac00240]
Genetic Information Processing; Transcription; RNA polymerase [PATH:mac03020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
702924..703106
Genome map
AA seq 60 aa AA seqDB search
MVKEKYTRFERARIVGARALQIAMGAPVLVDDDGRLDPLGVAIAELKAEIIPITVKRKKS
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
ttggtcaaggaaaagtatacccggttcgagcgtgcacgaattgtaggtgcaagagcattg
cagatagcaatgggggctcctgtcctggttgatgatgacgggcggctggaccccctgggt
gtagccattgcagagttgaaggccgaaattattcctataacggtcaaacgtaagaaaagc
tga

DBGET integrated database retrieval system