KEGG   Methanosarcina acetivorans: MA0826Help
Entry
MA0826            CDS       T00080                                 

Gene name
hat
Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mac  Methanosarcina acetivorans
Brite
Enzymes [BR:mac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MA0826 (hat)
Transfer RNA biogenesis [BR:mac03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MA0826 (hat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(961569..963212)
Genome map
AA seq 547 aa AA seqDB search
MKETDYNRACRNILEKVLAGEIKDEDQLNKVKKDVSKLYHLASLPRNGDIIMQGTPEEQA
VIKEFLRRKPVRTISGVAVIAVMTSPAPCPHGVCLPCPGGPNSAFKSPQSYMGREPAAMR
AIQHEFDPYAQVQSRLSQLKEIGHDVEKVELIVMGGTFSARSLDYQEWFSKRCLEAMNDF
TGTEWRENVRQIGKASPYIPLEEVQKANEVADIRNVGITFETRPDWAAEEHVDEFLRLGG
TKVELGVQSVYDFILTRMQRGHGVAEIVRANRVLRDSAFKVGFHMMPHLPGANSELDLRG
FKKLFEDPRFRPDYLKIYPTLVTEGTALYRMWEAGEYQALSDEEAAELVADIKSVLPKWV
RLQRIQRDIPAHQIFAGVRKSNLRQLAEEKLREKGGKCRCIRCREVGHNSLKGRRINEKD
IELTMESYEACNGTEHFIAFEDLSADVLIGFTRLRFPAAPHRQELQDSALIRELHVYGSM
VPVGKGAKQKEWQHRGYGKELIEHAEKIASEAGYGKLAIISGIGAREYYRKLGYNLDGLY
MAKTLKG
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaactgattataacagggcctgcaggaatatccttgaaaaggtacttgccggg
gaaataaaagacgaagaccagttgaacaaagtaaaaaaagacgtaagtaaactatatcat
cttgccagcctgcccaggaacggagatataattatgcagggtacacccgaagagcaggca
gtaataaaggagttcctcaggcgaaaacccgtaagaacaatttccggagttgcggtaatt
gccgtaatgacctcccctgccccatgcccccacggagtgtgcctgccctgccccggtggc
cccaattcggcttttaaatctcctcagagctacatgggaagagaacctgcagctatgagg
gcaattcaacacgagtttgacccttacgcccaggttcagtccaggctctcccagctaaag
gagataggccatgatgtggagaaggtagagctgatagtcatgggaggcacattctcagcc
cgcagcctcgattatcaggaatggttcagcaaacgctgccttgaggcgatgaacgacttc
acaggcaccgaatggagggaaaatgtccggcagatcggaaaagcttccccttacatcccg
cttgaagaggtccagaaagctaacgaagtagccgatatccggaacgtgggcataacattc
gaaacccgtcccgactgggcagcagaagaacatgtggacgagttcctcaggcttgggggg
acaaaggttgaacttggagtccagagtgtctatgattttattctgacgcggatgcagcga
ggacacggagttgcagaaatcgtcagagctaacagggttttaagagacagcgccttcaag
gtaggcttccacatgatgccccacctcccgggagcgaattccgaactcgatctaaggggg
tttaaaaaactctttgaagatcctcgcttcaggccggattacctcaagatttatccgacc
ctagtgaccgaaggcacagcgctgtacaggatgtgggaagccggagaatatcaggccctt
tccgatgaagaggcagcagaacttgttgccgacataaaatccgtcctgcccaaatgggta
agactccagcgcatccagcgggacattcccgcccaccagatctttgcaggcgtcagaaag
agtaacctcaggcagcttgcagaggaaaaactccgggaaaaaggaggtaaatgccgttgt
atacgctgcagggaagtagggcataacagcctgaaaggaagaaggataaacgaaaaagat
atcgagcttactatggaaagctacgaagcctgtaacggcacagaacatttcatcgctttt
gaagacctttcagcagacgtcctaataggctttacccggctgcgtttcccggctgccccc
caccgccaggaattacaggactccgcccttataagagaactgcatgtttacggctccatg
gtccctgtgggaaaaggggcaaaacaaaaggagtggcagcaccggggctatgggaaggaa
cttattgagcacgcggaaaaaatcgcatccgaggccggctatgggaaacttgcaataatc
agtggaatcggggccagagaatattaccgaaaactcgggtataatctcgacggactctat
atggcaaagacccttaagggctga

DBGET integrated database retrieval system