KEGG   Methanosarcina acetivorans: MA0877Help
Entry
MA0877            CDS       T00080                                 

Definition
magnesium-chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mac  Methanosarcina acetivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MA0877
Enzymes [BR:mac01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MA0877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1045683..1047797
Genome map
AA seq 704 aa AA seqDB search
MKNHNIINYPFTAIVGQEKMKKALVLNLINPKVGGVLIRGEKGTAKSTAVRALASLLPEI
EVVEGCKFKCDPNHTNEFCEECLGKLNAGTLRVSQVKMKVVDLPVSATEDRVVGTLDIEY
AIKTGEKRFEPGVLAMAHRGILYVDEINLLDDHLVDVLLDSAAMGVNTIEREGISFTHPA
NFVLVGTMNPEEGELRPQLLDRFGLCVDIRGINDLSLRVELIKYRLSYEADPEAFAAKWK
AAETELCEQILNAKQLLPEVRISDDMLELISQICIDMGVDGHRADLTMMKTSITLAAFYG
RTEVTEDDVREAAELTLSHRMRRKPFDNQPEKQDKLDESIEKQKEKQKEKKKEKPENKEE
KPKNEEEKEKKKEKHEHQNKEQHESPDQQQRQAEGSPPEESESQNAEQPDASTETTFEIG
EIYQVKQLSPEFRKEQRNGSGRRSKTLTRSKKGRYIKSSIPHEKTTDLAFDATLRAAAPF
QLTREKKGNSVAIHESDFREKIREKKIGNLVLFVVDASGSMGARQRMVASKGAVLSMLMD
AYQKRDKVGLIAFKGESAELLLPPTSSVELAQKYLQEMPTGGKTPLSRGLAKGYEVIKNE
LRRDPDTCPFMVLISDGRANVSMNGEPPLQETKTIASLFRDRGIQSAVIDTENSMIKFGL
AQEISSALGANYLALEDLKADSIVDAVRVSAPFDFKPEFSSSSM
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccacaacattataaactacccttttaccgctatagtcgggcaggaaaaaatg
aaaaaagccctggtcttaaatctcatcaaccctaaagtgggaggggtcctgatcaggggg
gaaaaaggcactgccaaatcgacagccgtccgggcgcttgccagcctcctgcctgaaatc
gaggtggttgagggctgcaaattcaaatgcgatcccaaccatacaaacgagttttgtgag
gagtgccttggaaaactaaatgcagggaccctgagagtttctcaggtaaaaatgaaagtt
gtggacctgcctgtgagtgctaccgaagaccgggttgtagggacccttgatatcgagtat
gctatcaaaacaggggaaaagcgttttgaacccggggtgctggcaatggctcacaggggc
atcctgtatgtggacgagattaaccttctcgacgaccaccttgtagatgtactcctggac
tctgcagcaatgggagtaaacactattgaaagagaggggatctcttttactcatcctgca
aattttgtgcttgtaggtaccatgaacccggaagaaggggaactgcggcctcagttgctg
gatcgtttcgggctctgtgtggacataaggggtatcaatgacctgtccctgagagttgaa
ctcataaaatacaggctcagttatgaggcagaccccgaggcttttgcagcaaaatggaag
gctgccgaaaccgagctttgcgagcagatcctcaatgcaaagcaattacttcccgaggtc
cggatctccgacgacatgcttgagctgataagccagatctgtattgatatgggagtggac
gggcacagggcagacctcaccatgatgaagacctcaattacgcttgcagctttttacggg
aggaccgaagtgaccgaggatgatgtccgggaggctgcagagcttactctttctcaccgc
atgcgcagaaagccttttgataatcaaccagaaaaacaggataaactggacgaaagtatt
gagaaacaaaaagaaaagcagaaggaaaaaaagaaggaaaaacccgaaaacaaggaagaa
aaaccgaaaaacgaggaagaaaaagagaaaaaaaaagaaaaacacgagcatcaaaataag
gaacagcacgaaagcccggatcagcagcagagacaggccgaagggagtccccctgaagag
tccgaatcccagaatgcagagcaaccggatgcttctacggaaacgacttttgaaataggg
gaaatctaccaggtaaaacaattatctccagaatttcgcaaggagcagcggaacggttca
ggcaggcgaagcaaaacccttacccggtctaaaaaaggccggtatataaaaagttcaatt
ccccatgaaaaaaccacggaccttgcttttgatgcaaccctgagggctgctgcccccttc
cagcttacgcgggagaagaaaggcaattccgtagcaattcatgagtccgatttcagggaa
aaaatccgggagaaaaagatcggaaaccttgtgctttttgtggttgatgcaagcggttcc
atgggagcccggcagcgtatggttgcgtccaaaggagcagtcctttcaatgcttatggac
gcttaccagaaacgcgacaaagtggggcttatcgcttttaaaggagaaagtgctgaactg
ctactccctcccacttccagtgtagaactggctcaaaagtatttgcaggaaatgcccaca
ggggggaagacccctctttcccggggtcttgcgaaaggttacgaggtcataaaaaacgaa
cttcggcgcgatcctgacacctgcccctttatggtcctgatttccgacggcagggcgaac
gtcagtatgaacggagaacctcctcttcaggaaacaaaaacaatagcctctttgttcagg
gatcggggcatacaatctgccgtaatcgacacggaaaacagcatgataaaattcgggctt
gctcaggaaatttcgagtgcccttggagccaattatctggccctggaagatttgaaagca
gattcaatagttgatgccgttcgagtttcagctccgtttgattttaagccggaattcagc
agctcttcaatgtga

DBGET integrated database retrieval system