KEGG   Methanosarcina acetivorans: MA1213Help
Entry
MA1213            CDS       T00080                                 

Gene name
nifH
Definition
nitrogenase reductase
Orthology
K02588  
nitrogenase iron protein NifH [EC:1.18.6.1]
Organism
mac  Methanosarcina acetivorans
Pathway
Chloroalkane and chloroalkene degradation
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    MA1213 (nifH)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MA1213 (nifH)
Enzymes [BR:mac01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.1  nitrogenase
     MA1213 (nifH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1446358..1447185
Genome map
AA seq 275 aa AA seqDB search
MTRKIAFYGKGGIGKSTTQQNTAAAMAYYHGKNVFIHGCDPKADCTRLALGGVPQTTIMD
TLRELGEEAVTVDNVVNTGFKGIRCVESGGPEPGVGCAGRGVITAINLMEELGAYSDDLD
FVHFDVLGDVVCGGFAMPIREGKAQEVYIVASGEMMATYAANNICKGLLKYAEQSGVRLG
GIICNSRKVDNELEMMEEFVSALGTQLIHFVPRDNIVQKAEFNKKTVVEFDPECNQAKEY
GKLAKKILENDMFVIPKPLSMDQLEKMVARYGLMD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccagaaaaattgctttttacgggaaaggtggtattggaaaatccaccactcaacaa
aatactgctgcagctatggcatattatcatggcaaaaatgttttcatccacgggtgtgat
cccaaagcagactgtactcgtctggcactcgggggcgtaccccagaccacaataatggat
acgctcagagagctgggtgaggaggccgtaacagttgataatgtagttaacaccggtttc
aaaggaatcagatgtgttgaatccggaggtccggaaccgggtgttgggtgtgctggcagg
ggtgtaatcaccgctattaacctcatggaggagctgggagcctattccgatgacctggat
tttgttcactttgatgtgcttggcgatgttgtctgcggcggatttgcaatgccaattcgg
gagggtaaagctcaggaagtatacatagtcgcttcgggagaaatgatggcgacttatgca
gcaaataatatctgcaaaggtctactgaagtatgcagaacagagcggggtgagattgggt
ggaatcatttgtaacagccgtaaggtcgataatgagctggaaatgatggaggagtttgtt
tccgcgcttggaacacagctgatacactttgtgccaagagataacattgttcaaaaggcg
gagtttaataaaaagacagttgtggagttcgacccggaatgcaaccaggcaaaagaatac
ggaaaacttgccaagaaaattcttgagaatgatatgttcgtgatccccaaaccgttaagt
atggatcaactggagaaaatggtggcaagatacggtcttatggattaa

DBGET integrated database retrieval system