KEGG   Methanosarcina acetivorans: MA1373Help
Entry
MA1373            CDS       T00080                                 

Definition
PfkB family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mac  Methanosarcina acetivorans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MA1373
Enzymes [BR:mac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MA1373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1640202..1641101
Genome map
AA seq 299 aa AA seqDB search
MDRIISVVGHTALDYIIDVENIAGKNESSPVIDYEEYPGGGAANIAVAIAKLGGKSQLMS
PVGMDFSSSGYEQLLKDAHVDLSRLYSIEALKLSKAFIFTDREDNQTTYFYWGASSKFKE
LEPEPVDFAHLATADCIYNAKIAQIAGFVSFDPGQDLVTYSQEKLETILAHTDILFANRH
EIKRVSEMTGKSFSELRAMIEVIVITYDAEGSRIYTGNEEWKIPVVSVKAVDPTGAGDAY
RAGFLLAYTREYSLPTCGKIGSTVASFAVQSRGCQTSLPTWEEMKSRYEASFGKLEVES
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggacagaattatttccgtagtggggcatactgcccttgattacatcatcgatgttgaa
aatatagcaggaaaaaacgagtcttcccctgtaattgactatgaagaatatcctggcgga
ggggctgcaaatattgcagttgccattgcaaagctaggaggaaaaagccagctgatgtct
cctgtcggaatggatttttcgagttcgggatatgagcaacttcttaaggacgcacacgtt
gacctctcccgcctttacagcattgaagccctgaaactttccaaggctttcattttcacg
gacagggaagacaaccagaccacctatttttactggggagcgtcctcaaagttcaaagag
cttgagcctgaacccgtagattttgcacacctggcaacagcagactgcatctacaatgca
aagatcgcgcaaattgccggttttgtctcgtttgatccgggacaggatctggtgacttac
tcacaagaaaaactcgagacaatccttgcccacacggatatcctctttgcaaaccggcac
gaaattaagcgggtttcggagatgaccgggaaaagcttctccgaactcagggctatgatt
gaggtcattgttataacatatgatgcagaaggcagcagaatttacaccggcaatgaagaa
tggaaaattcctgtagtttctgtaaaggccgtagaccctaccggagcaggagatgcttac
agggcaggttttctgctcgcctacacccgggagtattcccttcccacatgcggaaaaata
ggatcaactgtagcgtcctttgcggtacagtcccggggctgccagaccagccttccaacc
tgggaagagatgaaatcccgctatgaagccagcttcggaaaactggaagtagagagctga

DBGET integrated database retrieval system