KEGG   Methanosarcina acetivorans: MA1571Help
Entry
MA1571            CDS       T00080                                 

Definition
(RefSeq) dienelactone hydrolase family protein
  KO
K01061  
carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
mac  Methanosarcina acetivorans
Pathway
Chlorocyclohexane and chlorobenzene degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    MA1571
   00361 Chlorocyclohexane and chlorobenzene degradation
    MA1571
   00623 Toluene degradation
    MA1571
Enzymes [BR:mac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     MA1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1861660..1862529
Genome map
AA seq 289 aa AA seqDB search
MKFMKTLLLLLLIVCLIGVSGCTSSEDSEPDVPVPDTPEPSPDVPAVPRAAGNTSTDILN
ETVNITGESLEYPSYTAAPAVEGEYPAVVLIHSFNGFEPGYQEMVDRMAADGFVVVAPQW
QTYSRSPPDSEVEALVRNSVSYLESRDDVDPEKIGLTGFCAGGRYTMLFLPQIEEFNSGV
AWYGFPYSGGTETQPEAPANLTDQLEAPILIIHGTRDQASNVSDIYRYAGELDAADKYFE
LKVYQGEPHGFMVQDGELSESFVAQDAYDEMINFFDRTLNSGTMNNSSQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcatgaaaacactactcttacttttgctcatagtatgccttatcggcgtttca
ggctgcacaagttctgaagattccgaacctgacgttcctgtgcccgatactcctgaaccc
agtcccgatgtcccggctgttcccagagcagcagggaatacttcaactgacatcctgaac
gaaaccgttaatatcacaggtgagagtctggaatatccaagctatacggccgctccggct
gtagagggcgaatacccggctgtggtgcttatccactcctttaacggctttgaacccgga
taccaggagatggtggacaggatggcagcagacgggtttgttgtggttgctccgcagtgg
cagacctattcccgttcacctccggattctgaggtggaggcccttgtcagaaacagcgta
agttacctggagagcagggacgatgtggatccggaaaaaattggcctcaccggtttttgt
gcgggcggcaggtataccatgcttttcctgccccagatagaggagttcaattcaggagtt
gcctggtatggttttccttactcaggcgggactgaaacccagccggaagcacctgcaaac
ctgaccgaccagcttgaagccccgatccttatcatccacgggactcgcgaccaggcgagc
aatgtctcggatatctaccggtacgccggcgagctggatgcagctgacaagtatttcgaa
ctgaaagtttaccagggggaaccacacggtttcatggtccaagacggagaactttccgaa
agcttcgttgcacaggatgcatatgatgagatgattaatttctttgacaggacactgaat
tccggaacaatgaataattcgtctcagtga

DBGET integrated database retrieval system