KEGG   Methanosarcina acetivorans: MA1571Help
Entry
MA1571            CDS       T00080                                 

Definition
dienelactone hydrolase family protein
Orthology
K01061  
carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
mac  Methanosarcina acetivorans
Pathway
Chlorocyclohexane and chlorobenzene degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    MA1571
   00361 Chlorocyclohexane and chlorobenzene degradation
    MA1571
   00623 Toluene degradation
    MA1571
Enzymes [BR:mac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     MA1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1861660..1862529
Genome map
AA seq 289 aa AA seqDB search
MKFMKTLLLLLLIVCLIGVSGCTSSEDSEPDVPVPDTPEPSPDVPAVPRAAGNTSTDILN
ETVNITGESLEYPSYTAAPAVEGEYPAVVLIHSFNGFEPGYQEMVDRMAADGFVVVAPQW
QTYSRSPPDSEVEALVRNSVSYLESRDDVDPEKIGLTGFCAGGRYTMLFLPQIEEFNSGV
AWYGFPYSGGTETQPEAPANLTDQLEAPILIIHGTRDQASNVSDIYRYAGELDAADKYFE
LKVYQGEPHGFMVQDGELSESFVAQDAYDEMINFFDRTLNSGTMNNSSQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcatgaaaacactactcttacttttgctcatagtatgccttatcggcgtttca
ggctgcacaagttctgaagattccgaacctgacgttcctgtgcccgatactcctgaaccc
agtcccgatgtcccggctgttcccagagcagcagggaatacttcaactgacatcctgaac
gaaaccgttaatatcacaggtgagagtctggaatatccaagctatacggccgctccggct
gtagagggcgaatacccggctgtggtgcttatccactcctttaacggctttgaacccgga
taccaggagatggtggacaggatggcagcagacgggtttgttgtggttgctccgcagtgg
cagacctattcccgttcacctccggattctgaggtggaggcccttgtcagaaacagcgta
agttacctggagagcagggacgatgtggatccggaaaaaattggcctcaccggtttttgt
gcgggcggcaggtataccatgcttttcctgccccagatagaggagttcaattcaggagtt
gcctggtatggttttccttactcaggcgggactgaaacccagccggaagcacctgcaaac
ctgaccgaccagcttgaagccccgatccttatcatccacgggactcgcgaccaggcgagc
aatgtctcggatatctaccggtacgccggcgagctggatgcagctgacaagtatttcgaa
ctgaaagtttaccagggggaaccacacggtttcatggtccaagacggagaactttccgaa
agcttcgttgcacaggatgcatatgatgagatgattaatttctttgacaggacactgaat
tccggaacaatgaataattcgtctcagtga

DBGET integrated database retrieval system