KEGG   Methanosarcina acetivorans: MA1571Help
Entry
MA1571            CDS       T00080                                 

Definition
dienelactone hydrolase family protein
Orthology
K01061  
carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
mac  Methanosarcina acetivorans
Pathway
Chlorocyclohexane and chlorobenzene degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Fluorobenzoate degradation [PATH:mac00364]
Metabolism; Xenobiotics biodegradation and metabolism; Chlorocyclohexane and chlorobenzene degradation [PATH:mac00361]
Metabolism; Xenobiotics biodegradation and metabolism; Toluene degradation [PATH:mac00623]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1861660..1862529
Genome map
AA seq 289 aa AA seqDB search
MKFMKTLLLLLLIVCLIGVSGCTSSEDSEPDVPVPDTPEPSPDVPAVPRAAGNTSTDILN
ETVNITGESLEYPSYTAAPAVEGEYPAVVLIHSFNGFEPGYQEMVDRMAADGFVVVAPQW
QTYSRSPPDSEVEALVRNSVSYLESRDDVDPEKIGLTGFCAGGRYTMLFLPQIEEFNSGV
AWYGFPYSGGTETQPEAPANLTDQLEAPILIIHGTRDQASNVSDIYRYAGELDAADKYFE
LKVYQGEPHGFMVQDGELSESFVAQDAYDEMINFFDRTLNSGTMNNSSQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcatgaaaacactactcttacttttgctcatagtatgccttatcggcgtttca
ggctgcacaagttctgaagattccgaacctgacgttcctgtgcccgatactcctgaaccc
agtcccgatgtcccggctgttcccagagcagcagggaatacttcaactgacatcctgaac
gaaaccgttaatatcacaggtgagagtctggaatatccaagctatacggccgctccggct
gtagagggcgaatacccggctgtggtgcttatccactcctttaacggctttgaacccgga
taccaggagatggtggacaggatggcagcagacgggtttgttgtggttgctccgcagtgg
cagacctattcccgttcacctccggattctgaggtggaggcccttgtcagaaacagcgta
agttacctggagagcagggacgatgtggatccggaaaaaattggcctcaccggtttttgt
gcgggcggcaggtataccatgcttttcctgccccagatagaggagttcaattcaggagtt
gcctggtatggttttccttactcaggcgggactgaaacccagccggaagcacctgcaaac
ctgaccgaccagcttgaagccccgatccttatcatccacgggactcgcgaccaggcgagc
aatgtctcggatatctaccggtacgccggcgagctggatgcagctgacaagtatttcgaa
ctgaaagtttaccagggggaaccacacggtttcatggtccaagacggagaactttccgaa
agcttcgttgcacaggatgcatatgatgagatgattaatttctttgacaggacactgaat
tccggaacaatgaataattcgtctcagtga

DBGET integrated database retrieval system