KEGG   Methanosarcina acetivorans: MA1610Help
Entry
MA1610            CDS       T00080                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mac  Methanosarcina acetivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MA1610 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MA1610 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MA1610 (thrC)
Enzymes [BR:mac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MA1610 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1911151..1912368
Genome map
AA seq 405 aa AA seqDB search
MYHLKCIECGAEYSRDEVIYTCSKCDGLLDVIYDYSSIKIDMEKLKTECPSVWKYAKLLP
VEREPVTIQEGGTPLYKCDRLAEKIGIKKLYVKHEGMNPTGSFKDRGMTVGVTKALELGM
NTVACASTGNTSAALAIYGAKAGIPVVVLLPAGKVALGKVAQALMHGAKVLSIRGNFDDA
LALVRTLCSQEKIYLLNSINPYRLEGQKTIGFEIADQLDFKVPDRIVLPVGNAGNITAIY
KGFREFKILGITDSLPKMTGIQAEGSCPIVKAIKSGAPAITPEENPETVATAIRIGNPVN
ATKALSAIRESGGTAESVTDEEILAAQKDLARLEGIGVEPASAASVAGLRKLVDMGVIGR
DETVVCITTGHLLKDPQTVIDVCEEPTVVDANIDAIREAIFGKAK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacctgaaatgtatcgaatgcggtgcagagtattccagagatgaagtgatttat
acctgcagcaaatgtgacgggttgcttgatgttatttatgactattcttcaattaaaatc
gacatggaaaaattaaagaccgaatgtccctcggtctggaagtatgcaaaacttctgcct
gtggaaagggaacctgtcacgatccaggaaggcgggactcctctttataaatgtgaccgg
cttgccgaaaaaatagggataaaaaagctctatgtgaagcacgaaggcatgaacccgacc
ggttctttcaaggacaggggcatgactgtaggggttacgaaagcgcttgaactcggcatg
aacaccgttgcctgcgcatcaaccgggaacacttcggcagcccttgcaatctacggggca
aaagcaggaatccctgttgttgtgctgcttccggcaggaaaggtagctctcgggaaggtt
gcccaggccctgatgcacggggcaaaggtcctcagcatacgcggaaactttgacgacgca
cttgctcttgtgcgcacgctctgctcccaggaaaagatctatctcttaaactcaatcaac
ccttacaggctggaaggtcagaaaactatcggttttgagattgcagaccagctggatttc
aaggtgcctgataggattgtcctgcccgtaggaaacgcaggaaatatcactgctatctac
aagggcttcagggagttcaaaatcctcgggataacggactctcttccgaaaatgaccggg
atccaggccgaaggctcctgccccatagtaaaagccataaagagcggggctccggcaatt
acccccgaagagaatcccgaaaccgttgcaacggcaatccggatcggaaaccctgtaaac
gcaacaaaagccctcagtgccataagggaatccggcggcactgcggagtccgtgaccgat
gaagaaatccttgcagcccagaaagacctggcaaggcttgaaggcataggggtcgaaccc
gcaagtgcagcctcggttgcagggctcaggaaacttgttgatatgggtgttataggcagg
gacgaaaccgttgtctgtatcacgacaggccacctccttaaagaccctcagaccgtgatt
gatgtctgcgaggagccgacagttgttgatgcaaacatcgatgctatccgggaagcaatc
ttcggaaaggcaaaataa

DBGET integrated database retrieval system