KEGG   Methanosarcina acetivorans: MA1909Help
Entry
MA1909            CDS       T00080                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mac  Methanosarcina acetivorans
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:mac00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:mac00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2358143..2358688
Genome map
AA seq 181 aa AA seqDB search
MQVKSMEDFNKLEKPRVQNIPGFYGERLIEGVVVKDTKLFSDERGFLTELIRLDDEDMKA
QDIKQIIASYSYPGMIKGWHLHSKQEDHLFCVSGMVKVVLYDYREDSPTYKVLNEIFMGD
RYPRTVYIPPGIFHGTKNVGNDVSVVIGMPSLLYDPEDVDERRVNPISNNIIPYNWNCKM
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaaaaagtatggaggattttaataaactggaaaagccaagggtccaaaacatt
ccaggtttttatggagaaaggctgattgaaggtgttgttgtaaaggatactaaactgttt
agcgatgagagaggctttttgaccgagctcatacgtttagacgatgaagatatgaaagca
caggatatcaaacagataattgcttcctattcttatcccggaatgataaaaggctggcat
cttcactctaaacaggaagatcacctgttttgtgtaagtggaatggtaaaagttgtctta
tatgattacagagaagactcacctacgtataaagttttgaatgaaatttttatgggggat
aggtacccacgtacggtttatatcccaccaggaatctttcacggtacaaaaaatgtaggc
aatgatgtatctgtagtgataggaatgccttccctactctatgaccctgaagatgttgac
gaaagacgggttaatcccatttccaataatattattccctataattggaactgcaaaatg
gaatga

DBGET integrated database retrieval system