KEGG   Methanosarcina acetivorans: MA1966Help
Entry
MA1966            CDS       T00080                                 

Gene name
asn
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mac  Methanosarcina acetivorans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mac00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2429336..2430829
Genome map
AA seq 497 aa AA seqDB search
MCGIAGVFGTPDSNLKVKKMLAALGHRGPDACGIHTAGDLSIGNTLLKITGDMPQPLTGK
GALVLNGEIFNFRELAAEIGIKIDSDTELLFSLIETGVKEGSTPIDAVCSALSKVNGDYA
LAYACGGELVLARDPSGVKPLFYCSGTEGEKPEIAFASEKKALAFISRKAKPFPQGGILG
FNTESGKITEKIPEGYLEIKSPEKRIYTEHEALSQLKETLEKAVELRLTPTTGIAFSGGI
DSTFLAALAKRIDPGVSLYAVGLPDSHDITQAERAAEAIGMRKNLKVHFLSPEEIEAAVP
RVVYATESTDPMTVAIGIPLYIVAKTAKEDGKRVLLTGQGADELFGGYRRHEEFLKKGAE
VLDREIYSDLATISKINLERDDMVTMANSVELRVPFLDKEVIKTGLAIRPELKVLKKDGY
YEDGYYERKYILRKAAKGLIPPEILWKEKKAMQYGTGVQKVLDRLARDSGFSKKQESHIE
KYLMQIASEKGFEFVNN
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatagcgggcgtgttcggaacccctgacagtaatttgaaagtaaagaaaatg
cttgcagccctggggcacaggggacctgatgcctgtggaatccatactgcaggggacctg
agcataggaaataccctgcttaaaataacaggagatatgcctcagccgctcacaggaaaa
ggagctctcgtcctcaacggggaaatctttaatttccgcgagcttgcagctgagataggg
ataaaaatcgattccgataccgaactgcttttttcacttatagaaaccggggtaaaggaa
ggaagtactccgatagacgctgtctgctctgcactatccaaagtaaacggagactatgct
cttgcatatgcttgcggaggagaacttgtacttgccagggacccttcaggagtaaagcct
ctcttttactgttccgggacagagggcgaaaagccggaaatagcttttgcttccgaaaaa
aaagcccttgcttttattagcagaaaagcaaagcctttcccgcagggagggattctgggt
ttcaataccgaaagcgggaaaatcacagaaaaaatcccggaaggatacctggagataaaa
tcgcctgaaaagaggatttatacagaacatgaggctttgtctcaactgaaagaaactctt
gaaaaagctgtggaactcaggcttaccccgactacaggaattgcattttcaggaggtatt
gacagtacttttttagcagcccttgcaaaacgcatcgatcccggggtttccctttatgcg
gttgggcttccggattcccatgacattacccaggctgagagggcagctgaagctatcggt
atgaggaaaaacctgaaagtccatttcctctcgcccgaagaaatagaagctgcagtacct
cgggtagtctatgcaaccgaatccacggatccgatgacggttgcaataggaattcccctt
tatatcgtggcaaaaaccgcaaaagaagacgggaagcgagtccttctgaccggacagggg
gcggatgaactctttggagggtacaggaggcatgaagagtttctcaaaaagggggctgag
gtgctcgacagggagatctactcggaccttgcaaccatctcaaaaattaaccttgaaagg
gatgatatggttacaatggccaactccgtggaactccgggttcccttcctggataaagaa
gtaataaaaaccgggcttgcaatacgcccggagctgaaggtcctgaaaaaagatggctac
tatgaagacggctactacgaaagaaaatatattctcagaaaagcggcaaaagggttaatc
cctccggaaattctctggaaagagaaaaaagcaatgcaatacgggaccggagtacagaag
gtgctcgaccggcttgccagggattcgggcttttccaaaaagcaggagagccatatagaa
aaatacctcatgcaaattgcttcggaaaaaggttttgagtttgtaaataactga

DBGET integrated database retrieval system