KEGG   Methanosarcina acetivorans: MA2400Help
Entry
MA2400            CDS       T00080                                 

Gene name
gpmA
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mac  Methanosarcina acetivorans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MA2400 (gpmA)
   01230 Biosynthesis of amino acids
    MA2400 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MA2400 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MA2400 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MA2400 (gpmA)
Enzymes [BR:mac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MA2400 (gpmA)
Exosome [BR:mac04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MA2400 (gpmA)
  Exosomal proteins of melanoma cells
   MA2400 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2972077..2972823)
Genome map
AA seq 248 aa AA seqDB search
MSYLIIVRHGESGWNVDGRFGGWVDVPLTGKGIKEALLCAAELEGIDLDVTFTSKLIRAQ
ETLFLILSKQKKIGVFVHEEAGTGEDRTEREDGSRKDRKEKRYAYPPNTEKNLIPIHSNE
ALNERYYGILQGKKKDKMKAKYGEEQILHWCRSFDEGPPEGESLKDIYRRAVPYFEKEIF
PILQDGKNVIVCAHQNSLRALIKHIEGISNEDIRKIRLANARPVIYTFSGGRLVRENAET
DPSVKRNL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagttacctgataattgtacgacacggggaatccggctggaacgttgatggcaggttc
ggaggctgggttgacgttcctttgaccggaaaggggataaaagaagcccttctctgtgct
gccgaacttgaggggattgatctggacgttactttcacttcaaaactgattcgggcacag
gaaactctctttttaatcctttcaaagcagaaaaaaattggggtctttgtccacgaagaa
gccgggacaggagaggataggaccgaaagagaagacggatccaggaaggacagaaaagaa
aaacggtatgcttacccccctaataccgaaaaaaacctgatccctatccattcaaatgaa
gccttaaacgaacgctattacgggatacttcagggcaagaaaaaggacaaaatgaaagcg
aaatacggggaagagcagattctccactggtgccggagttttgacgaagggcctccggaa
ggggaaagcctcaaggatatctatagacgtgcggtgccatatttcgaaaaagagatcttt
cccatccttcaggacggaaaaaatgtaattgtctgtgctcaccagaacagtttacgagcg
ctgataaagcatattgaagggatttctaacgaagacatccgcaaaatcaggctggcaaat
gcaaggccagtaatctatacattctctggaggcaggctggtcagggaaaatgctgaaacg
gacccatcagtgaaaaggaatctctga

DBGET integrated database retrieval system