KEGG   Methanosarcina acetivorans: MA2665Help
Entry
MA2665            CDS       T00080                                 

Gene name
pmm
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mac  Methanosarcina acetivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MA2665 (pmm)
   00030 Pentose phosphate pathway
    MA2665 (pmm)
   00051 Fructose and mannose metabolism
    MA2665 (pmm)
   00052 Galactose metabolism
    MA2665 (pmm)
   00500 Starch and sucrose metabolism
    MA2665 (pmm)
   00520 Amino sugar and nucleotide sugar metabolism
    MA2665 (pmm)
  Nucleotide metabolism
   00230 Purine metabolism
    MA2665 (pmm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MA2665 (pmm)
Enzymes [BR:mac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MA2665 (pmm)
    5.4.2.8  phosphomannomutase
     MA2665 (pmm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3299700..3301175
Genome map
AA seq 491 aa AA seqDB search
MEYHKIRLIKNKVEEQIQVEEQIRQLGTFFTLITMGGLSMALFGTNGVRGIANEYITPEL
SVNLARSLGTYMSSKGTVAIGCDTRISGQMLKSAAIAGALSTGLNVIDVGSAPTPSIQYY
VRDHADAGIVITASHNPRQYNGIKFIAGDGTEFPRDGEKDIEKIYYSGKYSIVSWEKTGS
FRTDPDVNAYYIRNIINSVNAETIRGHSFKVVIDTGCGAGSLTLPFLLRALGCQVLTLEA
QPDGTFPWRNPEPLPEALTELTNLVKMTGADLGAAHDGDADRIVFVDENGQFINDDVLLA
MVAKYMLEHEKGPVVTPVSSSQRIADVAKDAGVELYWTAVGSINVARKMMEVNAVFGGEG
NGGLIFPKHQYCRDGAMGCAKVLEILAGGKKLSELAKSVPHYFNEKTKTPSKNKQVTMEI
VKKEASELGHKLDTTDGVKIWYEDGWVLIRPSGTEPIFRIYAEAKKQDRAKELMQEGLNM
VLKAEKSSTLK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtggaatatcacaaaattcgtctgataaagaataaagtagaagagcaaattcaagtagaa
gagcaaattcgccagcttggcacattttttactttgattacaatggggggactttctatg
gcattattcggaacaaacggtgtacgcggtatagccaatgaatacataactccggaactg
tcagtcaatttagccagaagtcttggtacatatatgagttcgaaaggcacggttgctata
ggatgtgatacccggatttcgggccagatgctgaaatctgccgcaattgccggggctctt
tcaacaggcctgaatgttattgatgtgggatccgctcctactccttctatccagtattac
gtacgcgaccatgcagatgccggaatcgttattactgcctctcacaaccccagacagtat
aacggaatcaaatttattgcaggggacggcacggaatttcccagggatggggaaaaagac
atagaaaaaatttattattcgggcaaatattccattgtatcctgggaaaaaaccggcagc
ttcagaactgatcctgacgttaatgcatactacataagaaacattatcaattcggtaaat
gctgaaaccatccgcggccacagtttcaaggtagttattgatacgggttgcggagcaggt
tcccttactcttccatttctactcagggctctgggctgccaggtattgacccttgaagcc
cagcctgacgggactttcccctggagaaaccccgaacccctgcctgaagcgcttaccgaa
cttactaacctcgtcaaaatgacaggcgccgatctgggagcggctcacgatggggacgcg
gatagaatagtctttgttgacgaaaacggacaattcattaacgacgacgttctgctcgcc
atggtggcaaaatatatgcttgaacacgaaaaaggtcctgtagtgacccctgtcagctct
tctcagcgcattgccgatgtcgcaaaggatgcaggagtcgaattgtactggactgctgtc
ggctccatcaacgttgcccgaaagatgatggaagtaaatgcagtttttggaggcgagggc
aacggagggcttattttcccaaagcatcaatactgcagagacggagcaatgggctgtgca
aaggtccttgagatcctggctggcgggaaaaagctatccgagcttgctaaaagtgtacct
cattacttcaacgaaaaaaccaagactccttctaaaaataagcaggtcactatggaaata
gtaaaaaaggaagcttcagagcttggacacaagctggatactaccgacggagttaaaata
tggtacgaagacggctgggttcttatccgtccatctggcacggaaccaattttccggatc
tatgccgaagcaaaaaagcaagacagagcaaaggaacttatgcaggaaggactgaatatg
gtcctgaaagcagagaagagctctactctcaaatga

DBGET integrated database retrieval system