KEGG   Methanosarcina acetivorans: MA2908Help
Entry
MA2908            CDS       T00080                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mac  Methanosarcina acetivorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3632437..3633543)
Genome map
AA seq 368 aa AA seqDB search
MRIGTTTLISILFLTALAVTASAEEVQLSQKEELGKLLFFDESLSMPRGQSCASCHDPDF
GFTDPDQDIPVSQGVIPILFGNRNAPSAAYATYSPNFSYTYDDSGQIIYYGGQFWDGRAD
NLTEQAKGPLLNPLEMHNPNKRTVVMSIRRSDYADLFEEVYGPCSLNNVDVAFDYAADAI
AVYESSEEVNTFSSRYDEYLEGEYTLSDEEKLGLELFNGKALCSGCHISSGSEPIFTDFT
YDNLGVPKNPDNPFYSIPRVYNPLRSAYVDLGLGGSGRTEITDPEGEEGKMKVPTLRNIG
KTAPYTHNGYFTNLEDIVHFYNTRDVASEGWPEPEVAANVNTEEMGDLGLNDSEERAIVA
FLLTLDDE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgggacaacaacactaatttcaattttatttttgacagcgctggctgtaact
gcctcagcagaagaagttcagctgagtcaaaaagaggaactagggaagcttctattcttt
gatgaaagcttatcaatgcccagaggacagtcctgtgcaagttgccacgatcctgatttt
ggttttactgaccctgatcaggacattcctgtttcacagggtgtaataccaatactgttc
gggaacagaaacgcaccaagtgctgcatatgcaacttatagtccaaatttcagctacact
tatgatgacagcggccagataatctattatggagggcagttctgggacggcagggcggat
aacctgacagagcaggcgaaaggccctctcctgaaccctctggaaatgcacaacccgaat
aaaaggaccgtggttatgagtatccgaagatcggactatgcagatctttttgaagaagtc
tacggaccatgttccctgaacaatgtagatgtggctttcgattatgcagctgatgcgatt
gcagtttatgaaagttctgaagaagtaaatacattcagttccaggtatgatgagtatctt
gaaggagagtatactctatcagatgaagagaaactgggactcgaattatttaatggaaaa
gccctgtgttcaggatgccatataagtagtggaagtgaaccgatatttacggacttcact
tatgacaatctgggtgtgcccaaaaaccctgataacccattttatagcataccaagagta
tataaccctctaaggagtgcatacgtagaccttggactgggaggaagcggtcgtaccgag
ataaccgatccagaaggtgaagagggaaaaatgaaagtccccactctccgaaacatagga
aagacagctccttacacacataatggatacttcaccaatctcgaagacattgtccacttc
tataatacgagggatgtagcatcagaaggatggccagagcctgaagttgccgcgaatgtt
aatactgaagaaatgggcgacctgggtctgaacgattcggaagaaagggcaattgttgcc
ttcctgctgacactggatgacgaataa

DBGET integrated database retrieval system