KEGG   Methanosarcina acetivorans: MA2912Help
Entry
MA2912            CDS       T00080                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mac  Methanosarcina acetivorans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MA2912
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MA2912
   00620 Pyruvate metabolism
    MA2912
   00640 Propanoate metabolism
    MA2912
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MA2912
   00680 Methane metabolism
    MA2912
Enzymes [BR:mac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MA2912
Lipid biosynthesis proteins [BR:mac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MA2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3638778..3640460)
Genome map
AA seq 560 aa AA seqDB search
MSRMTSLLSQFVSKTDFESYEDFQENFKILVPENFNFAYDVVDVYARDSPEKLAMIWCDD
YGNEKIFTFKDLKYYSDKAANFFVKHGIGKGDYVMLTLKSRYDFWYCMLGLHKLGAIAVP
ATHMLKTRDIVYRIEKAGLKMIVCIAEDDVPEQVDEAHAECGDIPLKKAKVGGDVLEGWI
DFRKELEESSPIFERPTGEVSTKNEDICLVYFSSGTAGFPKMVEHDNTYPLGHILTAKYW
QNVEDDGLHYTVADSGWGKCVWGKLYGQWIAGCAVFVYDYDRFEAKNMLEKASKYGVTTF
CAPPTIYRFLIKEDLSHYNFSTLKYAVVAGEPLNPEVFNRFLEFTGIKLMEGFGQTETVV
TIATFPWMEPKPGSIGKPTPGYKIELMDRDGRLCEVGEEGEIVINTMEGKPVGLFVHYGK
DPERTEETWHDGYYHTGDMAWMDEDGYLWFVGRADDIIKTSGYKVGPFEVESALIQHPAV
LECAITGVPDPVRGQVIKATIVLTKDYTPSDSLKNELQDHVKNVTAPYKYPRIIEFVPEL
PKTISGKIRRVEIRDKDQSQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagaatgacttccttgctgagccaatttgtttccaaaaccgatttcgaatcctac
gaggatttccaggaaaacttcaaaatcctggtccctgaaaacttcaactttgcctatgat
gtggtcgatgtctatgcaagagattctcctgaaaagcttgccatgatctggtgtgacgat
tacgggaatgagaaaatcttcactttcaaagatctcaagtactacagcgataaagctgca
aatttctttgtaaagcacggcataggcaaaggcgactatgtaatgcttaccttaaagagc
cgctatgatttctggtactgcatgctggggctacacaagctcggagcaatagccgtgcct
gcaacccacatgctgaaaacccgggatatagtatacagaatcgaaaaagccgggttgaag
atgattgtctgcatcgccgaagacgatgttccggaacaggtagatgaagcccatgccgaa
tgcggggatatccctctcaagaaagccaaggtaggaggagatgtcctggaaggctggatt
gatttcagaaaggaacttgaggaaagttccccgattttcgagcgtccgacaggcgaggtt
tcaacaaagaacgaagacatctgtctggtctacttctcctccggaaccgccggtttcccg
aaaatggtagagcacgacaacacctatccactcggccatatcctgaccgcaaaatactgg
cagaatgtggaagacgacgggctgcactacaccgttgcagacagcggatggggtaaatgt
gtctggggcaagctctacgggcagtggatagctggttgtgcggtctttgtctatgactat
gacaggtttgaagccaaaaatatgcttgaaaaggcctccaagtatggagttacgactttc
tgtgctccacccacgatctatcgtttcctgatcaaagaagacctctcccattataatttc
agcactctgaaatatgcggttgttgcaggcgaacccctcaaccctgaagtctttaaccgc
ttccttgagtttaccggaatcaaacttatggaaggtttcgggcaaaccgagaccgttgtt
acgattgcgaccttcccctggatggaacccaagcccggatctatcggaaaacccacccct
ggatataagatcgagctcatggacagggatggcaggctctgcgaggtcggagaagaaggg
gaaatcgtcatcaacacaatggaaggaaaacctgtgggactttttgtccactatggaaag
gatcctgaaaggacagaggagacctggcacgacggctactaccataccggagatatggcc
tggatggatgaagacggttatctctggtttgtgggaagggctgacgatataatcaagacc
tcaggatacaaggtcgggccctttgaagtggaaagcgctcttatccagcacccggctgtg
cttgagtgtgctatcacgggagtccccgaccctgtcagaggtcaggtcattaaggcgacc
attgtacttacaaaggattatacgccgagtgactcccttaaaaacgagctccaggatcat
gtgaaaaatgtcacggctccttacaagtatcccaggattattgaattcgttcccgaacta
ccgaaaaccatcagcggaaaaatccgcagggtcgaaatccgtgacaaggaccagagccaa
tga

DBGET integrated database retrieval system