KEGG   Methanosarcina acetivorans: MA2912Help
Entry
MA2912            CDS       T00080                                 

Definition
(RefSeq) AMP-binding protein
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mac  Methanosarcina acetivorans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MA2912
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MA2912
   00620 Pyruvate metabolism
    MA2912
   00640 Propanoate metabolism
    MA2912
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MA2912
   00680 Methane metabolism
    MA2912
Enzymes [BR:mac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MA2912
Lipid biosynthesis proteins [BR:mac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MA2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3638778..3640460)
Genome map
AA seq 560 aa AA seqDB search
MSRMTSLLSQFVSKTDFESYEDFQENFKILVPENFNFAYDVVDVYARDSPEKLAMIWCDD
YGNEKIFTFKDLKYYSDKAANFFVKHGIGKGDYVMLTLKSRYDFWYCMLGLHKLGAIAVP
ATHMLKTRDIVYRIEKAGLKMIVCIAEDDVPEQVDEAHAECGDIPLKKAKVGGDVLEGWI
DFRKELEESSPIFERPTGEVSTKNEDICLVYFSSGTAGFPKMVEHDNTYPLGHILTAKYW
QNVEDDGLHYTVADSGWGKCVWGKLYGQWIAGCAVFVYDYDRFEAKNMLEKASKYGVTTF
CAPPTIYRFLIKEDLSHYNFSTLKYAVVAGEPLNPEVFNRFLEFTGIKLMEGFGQTETVV
TIATFPWMEPKPGSIGKPTPGYKIELMDRDGRLCEVGEEGEIVINTMEGKPVGLFVHYGK
DPERTEETWHDGYYHTGDMAWMDEDGYLWFVGRADDIIKTSGYKVGPFEVESALIQHPAV
LECAITGVPDPVRGQVIKATIVLTKDYTPSDSLKNELQDHVKNVTAPYKYPRIIEFVPEL
PKTISGKIRRVEIRDKDQSQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagaatgacttccttgctgagccaatttgtttccaaaaccgatttcgaatcctac
gaggatttccaggaaaacttcaaaatcctggtccctgaaaacttcaactttgcctatgat
gtggtcgatgtctatgcaagagattctcctgaaaagcttgccatgatctggtgtgacgat
tacgggaatgagaaaatcttcactttcaaagatctcaagtactacagcgataaagctgca
aatttctttgtaaagcacggcataggcaaaggcgactatgtaatgcttaccttaaagagc
cgctatgatttctggtactgcatgctggggctacacaagctcggagcaatagccgtgcct
gcaacccacatgctgaaaacccgggatatagtatacagaatcgaaaaagccgggttgaag
atgattgtctgcatcgccgaagacgatgttccggaacaggtagatgaagcccatgccgaa
tgcggggatatccctctcaagaaagccaaggtaggaggagatgtcctggaaggctggatt
gatttcagaaaggaacttgaggaaagttccccgattttcgagcgtccgacaggcgaggtt
tcaacaaagaacgaagacatctgtctggtctacttctcctccggaaccgccggtttcccg
aaaatggtagagcacgacaacacctatccactcggccatatcctgaccgcaaaatactgg
cagaatgtggaagacgacgggctgcactacaccgttgcagacagcggatggggtaaatgt
gtctggggcaagctctacgggcagtggatagctggttgtgcggtctttgtctatgactat
gacaggtttgaagccaaaaatatgcttgaaaaggcctccaagtatggagttacgactttc
tgtgctccacccacgatctatcgtttcctgatcaaagaagacctctcccattataatttc
agcactctgaaatatgcggttgttgcaggcgaacccctcaaccctgaagtctttaaccgc
ttccttgagtttaccggaatcaaacttatggaaggtttcgggcaaaccgagaccgttgtt
acgattgcgaccttcccctggatggaacccaagcccggatctatcggaaaacccacccct
ggatataagatcgagctcatggacagggatggcaggctctgcgaggtcggagaagaaggg
gaaatcgtcatcaacacaatggaaggaaaacctgtgggactttttgtccactatggaaag
gatcctgaaaggacagaggagacctggcacgacggctactaccataccggagatatggcc
tggatggatgaagacggttatctctggtttgtgggaagggctgacgatataatcaagacc
tcaggatacaaggtcgggccctttgaagtggaaagcgctcttatccagcacccggctgtg
cttgagtgtgctatcacgggagtccccgaccctgtcagaggtcaggtcattaaggcgacc
attgtacttacaaaggattatacgccgagtgactcccttaaaaacgagctccaggatcat
gtgaaaaatgtcacggctccttacaagtatcccaggattattgaattcgttcccgaacta
ccgaaaaccatcagcggaaaaatccgcagggtcgaaatccgtgacaaggaccagagccaa
tga

DBGET integrated database retrieval system