KEGG   Methanosarcina acetivorans: MA2991Help
Entry
MA2991            CDS       T00080                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mac  Methanosarcina acetivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MA2991 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MA2991 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MA2991 (trpB)
Enzymes [BR:mac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MA2991 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3727563..3728774)
Genome map
AA seq 403 aa AA seqDB search
MTETKVSEFQLKGKYGKYGGQYVPEVLMPALEELDVGYEKYKNDPESLAELDHYLRDFAG
RETPLYFARNLSKKYGTKVYLKREDLVHGGAHKLNNALGQALLAKFMGKTRLIAETGAGQ
HGTATAMVGATLGFETIVYMGAKDIKRQQMNAYRMELMGTEVRAVETGSKTLKDAINEAM
RDWVTNIENTHYLIGSVVGPHPYPMIVRDFQSVIGKEVKEQAMEKEGRLPDSIIACAGGG
SNAMGTFHPFIEDREVKLIAVEAGGKGLKCTEKAALHSASLCIGEEGILHGARTKILQDK
NGQILESESVSAGLDYSGVGPELAYLSESGRVTARYVTDDEALDAFNELSRLEGIIPALE
SSHALAYLKKAAESGELGEFVVVNLSGRGDKDLETVLSLRRGV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgacagaaactaaagtttcagaatttcagctaaaaggaaagtatggaaaatacgggggg
cagtacgtacccgaagtcctaatgccggctctggaagagctggatgtggggtatgagaag
tacaaaaacgaccccgaatcccttgcagagcttgaccactacctcagggactttgcagga
agggaaacgcccctttactttgcccggaacctgagcaagaaatacgggacaaaagtctat
ctcaagcgggaagacctggtgcacgggggtgcccacaagctcaacaatgctctcgggcag
gctctgcttgcaaagttcatgggaaagaccaggctgattgctgagaccggggcagggcag
cacgggactgcaacagccatggtgggagcaacccttgggtttgagaccattgtctacatg
ggagcaaaagacatcaaacgccagcagatgaatgcttacaggatggaactcatggggacg
gaggtaagagccgtggagaccggctcaaaaaccctcaaggacgcaatcaacgaggcaatg
cgggattgggttaccaatattgaaaacacccactacctgatcgggtcggtggtcgggcct
catccctatcccatgatcgtaagggacttccagagcgtgatcgggaaggaagtaaaggag
caggcaatggaaaaagaaggcaggctgcctgattctatcatcgcctgtgcaggcggcggg
agcaatgccatggggactttccatccctttatagaagacagggaagtcaagctgattgcc
gtagaagccgggggaaaagggctgaagtgcacggaaaaagctgctcttcactcagcttcc
ctctgtatcggagaagaaggaatcctgcacggagccaggacaaagatcctgcaggacaaa
aacggacagatccttgaatcagaatccgtatcagcagggcttgactactcaggggtcggc
cctgaacttgcttacctttcggaaagcggcagggttacagctcgctatgtcacagatgat
gaagcgcttgacgcttttaacgaactgagccggcttgaagggatcattcctgccctcgag
tcctcccatgcccttgcctacctgaaaaaagccgcagagtcaggagaacttggagagttt
gtggtagtgaacctctcaggaaggggagataaagacctggaaaccgtcctgagccttaga
aggggggtctga

DBGET integrated database retrieval system