KEGG   Methanosarcina acetivorans: MA3198Help
Entry
MA3198            CDS       T00080                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mac  Methanosarcina acetivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mac01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mac00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mac00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3958609..3959937
Genome map
AA seq 442 aa AA seqDB search
MYRNDVKEISMEQTKIILDENEMPKKWYNVLADLPSPIDPPLDPRTWQPISPDALEPIFP
KALIMQEMSSDRYIDIPEEVLDVYRLWRPSPLFRAHQLEKVLKSPAKIYYKYEGVSPAGS
HKTNTSIAQAYYNMKEGTERLTTETGAGQWGSALSLACNYFDLECKVYMVRSSFYQKPYR
KSLITLWGGNVVPSPSPDTEFGRKILQEQPDTPGSLGIAISEAVEDAIAHENTKYSLGSV
LNHVVLHQTVIGAECKQQLAQVEEYPDVVIGCCGGGSNLGGIGLEFIKDRLEGKHSARVV
AVEPSACPSLTKGEYRYDFGDTAEMTPLLKMYTLGHKHVPPAIHAGGLRYHGDSPIISKL
CSEGLMEAVSYDQQEVFDAAVQFARTEGIVPAPESSHAIRCAIDEALAAKQTGEEKTILF
NLSGHGHFDMSSYDKYFSGELM
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtacagaaatgatgtgaaggagatttccatggaacagacaaagattatccttgacgaa
aacgagatgccaaagaaatggtacaatgtccttgccgacctcccatctccgattgacccg
cctctggatccaagaacctggcagcctataagcccggatgctcttgagcccatttttcca
aaagccctgataatgcaggaaatgagcagcgaccggtatatcgatatccctgaggaagtg
cttgatgtttacaggctctggagaccaagcccgctgttcagagctcaccagctggaaaaa
gtcctcaagagcccggcaaaaatttactacaaatacgaaggagttagccctgcaggcagc
cacaagacaaatacctcgatcgcccaggcttactataacatgaaagaggggaccgagagg
ctcacaaccgaaaccggcgccggccagtggggaagtgcactttctcttgcctgcaattac
ttcgatctcgagtgcaaggtatatatggtccgttccagtttctaccagaagccttaccga
aaatcccttataaccctatggggaggaaacgtcgtgccttccccaagcccggacacggaa
ttcgggaggaagatcctgcaggagcagcctgacacccccggaagcctcgggattgcgatc
agcgaggctgtcgaggacgcaatagctcatgagaacacaaagtattccctcggaagtgtg
cttaaccatgttgtgctgcaccagaccgtaataggtgcagagtgcaaacagcagcttgcg
caggtcgaagaataccctgacgtggttatcgggtgctgtggcggtggaagcaatctcgga
ggaatagggcttgagttcataaaagacaggcttgaaggaaaacacagcgcaagagtggtt
gcagtcgaaccctcagcctgcccgtccctgacaaagggagagtacaggtacgacttcgga
gacactgccgagatgacccctctccttaagatgtacacactaggccacaagcatgtaccg
cctgccatccatgccgggggactccgctaccacggggactctccgatcataagcaaactc
tgctccgaagggcttatggaagctgtttcatatgaccagcaggaagtttttgatgcagcc
gtacagtttgccaggaccgaaggaatcgttcctgcacctgaatcttcccacgccatccgc
tgtgcgattgacgaagcgcttgctgccaaacagaccggagaagaaaagactatcctcttc
aacctgagcgggcacgggcactttgacatgtcctcctatgacaaatatttcagcggggaa
cttatgtaa

DBGET integrated database retrieval system