KEGG   Methanosarcina acetivorans: MA3242Help
Entry
MA3242            CDS       T00080                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mac  Methanosarcina acetivorans
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mac00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4001796..4003316)
Genome map
AA seq 506 aa AA seqDB search
MRLNLEHFDIKIGQHKVMFNVADAKELGVNPGDRVRIRGHQSISAIVDTTEDMVPPGTLG
VFSEVYEHFEDWDKPVEVVPALRSKSSGVIKKMLDKKSVLQDEIKLLVNDIVEENLSDVE
LSAFITASYIHGMTDDEVEWLTRAMIDTGDTIEFDTHPVMDKHSIGGVPGNKISLLVVPI
VAANGLLIPKTSSRAITGAGGTADLMEVLSPVEFSSEEVKEIAEKVGGALVWGGATNIAP
ADDKLIRVEYPLSIDPYYQMLASIMAKKGAIGAENVVMDIPIGPSTKVPTVQEGQKLARD
LINLGHRLGMNVECAITYGSSPIGRRVGPCLEVREAMKVLESMEGPNSLIEKSAALAGIL
LEMGGAAPRDRGKELALETLRNGKALEKMKQIIEAQGGDPNIKSDDIQVGQYTADIYAST
DGYVIEFDNKWIIEIARLAGAPNDKGAGVAIHKKMGEQVKKGDAILTIYAEKEFKLDLAL
TTAQRTNPIIVEGMLLKRIPGIYGFQ
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgaatcttgaacattttgatataaaaatcgggcaacacaaagttatgttcaat
gttgccgatgcaaaggaactgggagtaaatccgggtgatagggtccgcatccgtgggcat
cagagcatttctgccattgtggatacaaccgaggatatggttcctccaggtactctgggc
gttttttctgaagtttacgagcacttcgaggactgggataagccggttgaagttgttccg
gcattacgctcaaaatcttcaggcgttatcaagaagatgctggacaaaaagtctgttctt
caggatgagatcaaattacttgtaaacgatatcgtggaagaaaacctcagtgatgtcgaa
ctttcggcttttataacagcttcttatatccacgggatgaccgatgacgaggtagaatgg
ctgacaagggccatgatcgataccggagatacgatcgaattcgacactcatcctgtcatg
gacaagcactcgataggaggggtacccgggaacaagatttcccttctcgttgttcctatc
gtcgctgcaaacgggcttctcatccccaagaccagttccagggcaatcacaggtgcgggc
gggactgcagacctcatggaagttctcagtcccgttgagttcagctcagaggaagtcaag
gagatagctgagaaagtaggaggtgcgcttgtctggggaggagccacaaacatcgcacct
gcggatgacaaacttatcagggtcgaataccccctgtccattgacccttactaccagatg
cttgcctcgatcatggcaaaaaaaggagctatcggggccgaaaatgtggtaatggacatc
cccatagggccgagtacgaaggttccgacggttcaggaggggcagaaactggcaagggac
cttataaacctcgggcacagacttggaatgaatgtcgagtgtgccattacttatggttcg
tctcctattgggagaagagtaggcccctgtctggaagtaagggaagccatgaaagtgctg
gaaagcatggaaggcccgaacagccttattgaaaaaagtgctgcccttgcaggcattctg
cttgagatgggaggagcggctccaagggaccgcggaaaagagcttgcattggaaacactc
cggaacggaaaagcccttgaaaagatgaaacagatcattgaagcccagggcggagaccct
aacattaagtccgatgatatccaggtagggcagtacactgctgacatctatgcttctaca
gacgggtatgttattgagtttgacaacaagtggataattgagattgccaggcttgcagga
gctcccaatgacaaaggagccggggttgcaatccacaagaaaatgggagagcaggtcaaa
aaaggagatgccattctcacaatttatgctgaaaaagaattcaaactcgatctcgcactg
actaccgcccagaggacaaatccgataatagtcgaaggcatgcttctgaagagaatcccg
ggaatttatggattccagtga

DBGET integrated database retrieval system