KEGG   Methanosarcina acetivorans: MA3268Help
Entry
MA3268            CDS       T00080                                 

Gene name
rimK
Definition
ribosomal protein S6 modification protein
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mac  Methanosarcina acetivorans
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MA3268 (rimK)
Enzymes [BR:mac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     MA3268 (rimK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4033545..4034519
Genome map
AA seq 324 aa AA seqDB search
MKKIGIAITDPEDWTARALITAAKEKGFFPFILDLRIAEVSISSKTSEPATLFKAGEILL
SDLDALIVRDVGAGAFEGVSFRFDILRELEAGGVTVMNSPEAIQNAANKYHASYLLARAG
LPVPETVAVQSVEAALRAASGFGDAVIKPVFGYKGKDIARVKDGEIRFSDRKTGPGTVEE
ILEKLLEERGMLYIQEFIENPGRDIRAFVVGGKAIGAIYRKAAAGSWVNNLSRGGSADRC
VLAEEQKEIAEKAALAVGTTFAGIDIIEGAKAQTGNENKKTEDKSTGQGSRILEVNGTPS
GKGIFDAWGINPAEYILEYLQNIL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagggatcgcgatcaccgacccggaagactggacagcccgggcactcatc
actgcagcgaaggaaaaaggcttttttccttttattctggacctcaggatagcagaggtt
agcataagttcaaaaacttccgagccggcaactctttttaaagcaggggaaatcctgctc
tcggatcttgacgcccttattgtcagagatgtaggggcaggggcttttgaaggagtgtct
ttcaggtttgatatcctgagggaactggaggcaggaggagtcacggtcatgaactctccg
gaagcaattcagaatgcagcaaacaagtaccatgcttcttacctcctggcaagagccggg
ctgccagtgcctgagactgtagccgtccagagcgttgaagcagccttaagggcagcgtcc
gggttcggagatgccgtcataaaacctgtttttggatataagggaaaggatatcgcaagg
gtaaaagacggagaaatcaggttttcagaccggaaaacaggacctggaactgtggaagag
attcttgaaaagctgcttgaagagagggggatgctgtatattcaggaatttatagaaaac
cctgggagggacatcagggcttttgtcgtgggaggcaaagcaataggtgcaatttaccga
aaagctgctgcaggttcctgggtaaacaacctcagccgaggaggaagtgcagaccgctgt
gtacttgcagaggaacaaaaagaaatcgcggaaaaagccgcccttgcagtaggcacgaca
tttgcgggtattgatataatagaaggggccaaagctcaaactggcaatgaaaataaaaaa
actgaagataaaagcactggccagggctccaggatacttgaagtcaacggaacgccttca
ggaaaagggattttcgatgcatgggggattaaccctgccgaatatatcctggaatacctg
caaaatattttatga

DBGET integrated database retrieval system