KEGG   Methanosarcina acetivorans: MA3271Help
Entry
MA3271            CDS       T00080                                 

Gene name
truD
Definition
tRNA pseudouridine synthase D (EC:5.4.99.12)
Orthology
K06176  
tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
mac  Methanosarcina acetivorans
Brite
Enzymes [BR:mac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.27  tRNA pseudouridine13 synthase
     MA3271 (truD)
Transfer RNA biogenesis [BR:mac03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    MA3271 (truD)
 Prokaryotic Type
    MA3271 (truD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4036743..4038068
Genome map
AA seq 441 aa AA seqDB search
MQPMEVPEIEKQIGINLYSTNTEGLGGRLRQEVEDFIVKEITNREEGKDGRYLVLELTKR
DWDTHHFTRTLAKILQISQKRISVAGTKDKRALTTQKISIFDIDALEIEKIHLKDVELKV
LGRSRKSVELGDLWGNEFIITIRDISSSPEETRTILEKTNSKVLTQGGVPNFFGVQRFGS
VRSVTHLVGKAIVEGNFEKAAMLYIAEPFPEEPEETKAARQFVKETRDFKEGLKTYPLRL
GHERAMMNHLISNPEDYSGAFSVLPKNLYRMFVHAYQSYIYNMILCRRIESGISLNRAVE
GDIVCFRNEAGLPDSSKTEKVTSETVNAMNRLIKHGRAFITAPLPGFNTEFASGVPGEIE
SKILKELRVSLEGFNVEEFPEMSSKGTRREVLLQVEPKFEVGEDELNPGKSKTVLEFMLP
KGSYATTVLREYMKVDPLQMS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacccatggaagttccagaaattgaaaaacagatcggaataaatctttactctact
aacaccgaaggtctcggaggtcgactccggcaggaagtggaggattttattgttaaagag
attacaaatagagaggaaggaaaggatgggagataccttgttctcgaactcacaaaacgc
gactgggatacccaccactttacccggaccctggcaaaaatcctgcagataagccagaag
cgaataagcgttgcaggcacaaaagacaagcgagccctcaccacccagaagatcagcatt
ttcgatatcgatgccctggaaattgaaaaaatccatttaaaagatgtagagctgaaagtc
ctgggtcgatcccgaaagtccgtggaactcggagacctgtggggaaacgagtttataatt
acaatcagggacatatcaagttctcccgaagaaaccagaaccatactggagaaaacaaac
agcaaagtcctgacccagggaggagtcccgaattttttcggggtccagcgtttcggctct
gtccgctctgtgactcacctggtcggaaaagccattgttgaaggaaactttgaaaaagct
gccatgctctacattgccgagcccttcccggaagaacccgaggagacaaaagcagcccgc
cagttcgtaaaagagacccgcgacttcaaagaaggcctcaaaacctatcccctccgcctg
ggccacgaaagggcaatgatgaaccacctcatctcaaaccctgaggactattccggagcc
ttcagcgtgctccctaaaaacctgtacaggatgttcgtacacgcctaccagtcttatatt
tataacatgatcctctgccgcaggatcgaaagtggcatctccttaaacagggcagtggaa
ggagacatcgtctgcttcaggaacgaagccgggcttccggactcatcaaagacggaaaaa
gtcacttccgaaaccgtaaacgccatgaaccgcctgataaagcacggcagagccttcata
accgcccctcttccgggctttaacaccgaatttgcatccggggtccccggagaaatcgaa
agtaagatccttaaagaacttagagtttcgcttgaaggctttaatgtggaagagttcccg
gaaatgagttcgaaaggtacccgcagagaagtcctcctgcaggttgaaccgaaatttgag
gttggagaagacgagttaaaccctggaaaatcaaaaactgtgcttgagttcatgctgccc
aagggaagttacgctacaaccgtgctgcgggaatacatgaaagttgatcccttgcagatg
agctga

DBGET integrated database retrieval system