KEGG   Methanosarcina acetivorans: MA3516Help
Entry
MA3516            CDS       T00080                                 

Gene name
dhpS
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mac  Methanosarcina acetivorans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MA3516 (dhpS)
Enzymes [BR:mac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MA3516 (dhpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4351814..4353148)
Genome map
AA seq 444 aa AA seqDB search
MFVYACYCLRTLFIHSYLSSAIAPTELKAIIAWLSKMVVDTDICGLKVGDQYPAHVMGII
NLSPESFYEGSVTSPESALDVARKMVEDGATFLDLGARSTWRFSKPISKKEELDRLLPVL
DSLEGDVDAVISVDTMFSEIAEEALKRGADIINDVSGFTVDPRMIEVVADHDCPAVVMAS
NKIPGDPLGMDAIIEALGSIIEAAGAGGIGPDNLILDPAIGRWTDEKLPIYDFETLDDFE
RLKIFEKPLLAALSRKSFIGEVLGKTANDRLYGSLAAAAIAVHKGAHIIRTHDVPETTDV
VKLAGALRSRTSVVKEGRYEVSVLEVKTPQDAGIAMRNLGATRVGSQVMQGKSIHLTLKI
GNLTTTEALIIKQEMLSRGGDAALARDAVSHETESTDVLVMGTLLQFERLARKLGGQARS
LPLIAEMIRECIANRTNLEYRYLR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgtttatgcatgttattgcttacgcacattgtttattcactcatatttatcaagc
gcaattgcgccaactgagttaaaagctataatagcctggttgtcaaaaatggtagttgat
actgatatctgtggtctgaaagtgggagatcaatatcctgcacacgtaatgggcattatt
aacctgagcccggaatctttttacgaaggttcggttacaagcccggaatccgcacttgat
gttgcccggaaaatggttgaagacggagcaacttttctggatctgggagcccggtcaaca
tggcgtttttccaaacccataagcaaaaaagaagaactcgatcgattactgcccgtgctt
gattcgctggaaggcgatgtggatgcggtaatttccgttgatactatgttttccgaaatt
gcagaagaggctcttaagagaggggcagatatcataaacgatgtttccggctttacggta
gatccccgaatgatagaagtggtagcagaccatgactgtccggcagtggttatggcttct
aacaaaattcccggagatcctctgggcatggatgccattattgaagctcttggctccatt
atagaggctgccggagctggcggtataggacctgacaacctcatccttgaccctgcaatt
ggcaggtggactgatgaaaagctgcccatttatgattttgaaaccctggatgatttcgag
cgcctgaagatttttgaaaaacctctgcttgcggctctttcaaggaagtccttcataggc
gaagttcttggaaaaactgcaaatgacaggctctatggcagcctggctgcagcagcaatt
gcagttcacaagggtgcacatattatccgtacccatgatgtccccgaaactactgacgtt
gtcaagcttgcaggagctctgaggagccggacaagcgttgtaaaggagggcaggtatgag
gtctcggtacttgaggtaaaaactcctcaggacgcaggcattgcaatgaggaatcttggg
gctacaagggtaggttctcaggtaatgcagggaaaaagcatccatcttacgttaaagatc
ggaaaccttacaaccactgaggctctgataataaaacaggagatgctttcaaggggagga
gacgcggcccttgcaagagatgcagtttcccatgaaacggaatcgaccgatgtgcttgtg
atgggcactctgctgcaatttgaacgcctcgccagaaaactgggaggacaggctcgttcc
ctcccactgattgcagaaatgatccgtgaatgtattgcaaatcggactaatctagaatac
cgatatttgaggtaa

DBGET integrated database retrieval system