KEGG   Methanosarcina acetivorans: MA3780Help
Entry
MA3780            CDS       T00080                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mac  Methanosarcina acetivorans
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MA3780 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MA3780 (rfbC)
Enzymes [BR:mac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MA3780 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4663301..4663852)
Genome map
AA seq 183 aa AA seqDB search
MKLINTEIKDLFILEPDVFGDDRGYFFESYNKMKLDALIGKMYHFVQDNESKSSYGVIRG
LHYQLAPFSQTKLVRVLQGKVYDVAVDLRKDSPTFGKWFGVELSGENKRQFIIPKGFAHG
FSVLSETAVFVYKCDEYYHPETEAGIAYNDPSLNIDWKVRDEDIKVSPKDGLLPRFEKAE
INF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgattaatactgagataaaagatctcttcatactcgaacctgatgtttttggg
gatgataggggttacttttttgaaagttacaataaaatgaaacttgacgctcttattgga
aagatgtaccattttgttcaggacaatgaatccaagtcttcttatggggttattcgcggg
ttgcactatcaactggctcctttcagtcagacgaaacttgtgagagttttgcagggaaag
gtatatgacgttgccgtagacctcaggaaagactctcctactttcgggaagtggtttgga
gttgaactttccggcgagaacaaaagacagttcattatcccaaagggttttgcccatgga
ttttcagtactgagtgaaaccgcagtttttgtgtacaagtgtgatgaatactatcatccc
gaaactgaggcaggaatcgcatacaacgacccttcattgaatattgattggaaagtaagg
gatgaagatataaaggtttctccaaaagatggtctgctgcccagatttgaaaaagccgaa
attaacttttaa

DBGET integrated database retrieval system