KEGG   Methanosarcina acetivorans: MA3849Help
Entry
MA3849            CDS       T00080                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mac  Methanosarcina acetivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mac00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4729726..4730772)
Genome map
AA seq 348 aa AA seqDB search
MKSLLEVFTNAHGISGSEDEVRKLLEQELKPYVDSMRKDTMGNLIAIKEGKGPSVMLAAH
MDEIGLMVRYIDENGFLRFVGIGGWFSQTLLNQRVIVHGKKGSIYGVIGSKPPHVMKDED
RKKPVKLEDMFIDIGAKDREDAENLGIEIGTTVSIDQEFMPLANGKVTSKAFDNRAGVVI
LLEVMKRLHERKIEANVYAVGTVQEEVGLKGAKTCAFGLCPDVALALDTTIPGDHPGISK
TDSALELGKGPAITVADASGRGLIAHPQVLKWLRETADANEIPYQLGVGSGGTTDATSIH
LTKEGIPTGTVSIATRYIHSPVEVLDMADIEACVSLIVKSIENVKTYF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ataaaatcccttctcgaagtgttcacaaacgcccatgggatttccggctctgaagatgaa
gtccggaaacttcttgaacaggagctcaagccatatgttgacagtatgaggaaagacacc
atggggaaccttattgctattaaagagggaaaaggaccctctgtaatgctggccgcccat
atggatgaaatcgggctgatggtcaggtatattgatgagaacgggttcctgcgctttgtc
gggataggaggctggtttagccagactcttctgaaccagagagtcatcgtacacggcaaa
aagggctctatttacggagttataggttcaaaacctccccatgtgatgaaagacgaggat
agaaaaaagcccgtgaaacttgaggatatgtttattgatataggggcaaaggatagagag
gacgcagagaacctgggaatcgagataggcactacggtttcaatcgaccaggaattcatg
cccctggcaaacgggaaggttacatccaaggcttttgacaatcgcgcaggagttgtaatt
ctccttgaggtcatgaaacggcttcacgaacgcaaaatagaagcaaatgtctatgccgtg
ggcacggttcaggaagaagtgggacttaaaggagcaaaaacctgtgctttcgggctctgt
ccggatgtagcccttgcccttgacaccaccattccgggagaccatcctggtatcagcaag
acggattctgccctggagctgggaaaagggcctgcaataactgtagcagacgcatctgga
agaggactcatagcccatccccaggttctcaaatggctccgggaaaccgcggatgcaaac
gagatcccgtatcagctgggtgtaggttccggcggcactaccgatgctacgtcaatccat
cttacaaaggaaggtattcctacaggtacggtcagtatagcaacccgctatatccactcc
ccggtagaagttctggatatggcagatatagaagcgtgcgtgtctctgattgtaaagtca
atagaaaatgtaaaaacatacttctaa

DBGET integrated database retrieval system