KEGG   Methanosarcina acetivorans: MA4459Help
Entry
MA4459            CDS       T00080                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mac  Methanosarcina acetivorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MA4459
   00052 Galactose metabolism
    MA4459
   00500 Starch and sucrose metabolism
    MA4459
   00520 Amino sugar and nucleotide sugar metabolism
    MA4459
Enzymes [BR:mac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MA4459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5507807..5508763)
Genome map
AA seq 318 aa AA seqDB search
MKSISTQCKNKFLRNFSFYGELTVTIKKALIPAAGLGTRFLPATKSMPKEMLPIIDTPVI
QYVVEEAIASGIEDIIIITGRGKRAIEDYFDDSPELEMHLAKKNQTDMLKLVRDISSLVD
IHYIRQKEPNGLGDAVLRAENHIGNEPFAVLLGDDIIVNDKPCTAQLIENFEKYGRSTIA
VEEVPYEKLNSYGIIKGRPLDDSLYVLEDIVEKPSPEEAPSNIGAIGRYVFTPEIFDCIK
KAGTGVGSEIQLTDGIRLLSRSQMIYACRFKGKRFDTGDRLGYIKSIIDFALQNESLRDN
VLEYLREILAVEKVTAEK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtatttcaactcagtgtaagaataaatttttacgtaatttttccttttacgga
gagttaaccgtgactattaaaaaagcactcattccggcagccggtttaggaacccgtttc
ctgcctgccactaagtccatgccaaaagaaatgctcccgatcattgacactcccgtcatc
cagtatgtcgtggaggaggctatagcctcagggatcgaggacataatcattatcactgga
agaggcaagagagccatcgaagattacttcgacgactcccctgaacttgaaatgcacctt
gcgaaaaagaaccagacagacatgttgaaactggtcagggacatctcctctcttgttgat
atccactatatccgccagaaagagcctaacgggcttggggatgcagttctcagggcagag
aaccatatcggaaatgaaccttttgcggtgcttctcggagacgacattatcgttaatgat
aaaccctgcactgcccagcttatcgagaactttgaaaaatacggaaggtcaaccatcgca
gttgaagaggtgccttacgaaaaactgaacagttacggaattataaagggcaggcctctt
gacgattccctgtacgtgcttgaggatatcgtggaaaaaccctctcccgaagaggctcct
tctaatatcggggcaattgggcgctacgttttcactcctgaaatttttgattgcattaaa
aaagccggaaccggagtggggagcgagatccagcttacggacggcatcaggctcctgagc
aggtctcagatgatctacgcttgcaggttcaaaggaaaaaggttcgatacgggagaccga
cttggatatataaaatctataatcgactttgcccttcagaacgaaagcctcagagacaat
gtacttgagtacctgcgggaaatcctggcagttgaaaaggtcacggcagaaaagtaa

DBGET integrated database retrieval system