KEGG   Methanosarcina acetivorans: MA4459Help
Entry
MA4459            CDS       T00080                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mac  Methanosarcina acetivorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MA4459
   00052 Galactose metabolism
    MA4459
   00500 Starch and sucrose metabolism
    MA4459
   00520 Amino sugar and nucleotide sugar metabolism
    MA4459
Enzymes [BR:mac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MA4459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5507807..5508763)
Genome map
AA seq 318 aa AA seqDB search
MKSISTQCKNKFLRNFSFYGELTVTIKKALIPAAGLGTRFLPATKSMPKEMLPIIDTPVI
QYVVEEAIASGIEDIIIITGRGKRAIEDYFDDSPELEMHLAKKNQTDMLKLVRDISSLVD
IHYIRQKEPNGLGDAVLRAENHIGNEPFAVLLGDDIIVNDKPCTAQLIENFEKYGRSTIA
VEEVPYEKLNSYGIIKGRPLDDSLYVLEDIVEKPSPEEAPSNIGAIGRYVFTPEIFDCIK
KAGTGVGSEIQLTDGIRLLSRSQMIYACRFKGKRFDTGDRLGYIKSIIDFALQNESLRDN
VLEYLREILAVEKVTAEK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtatttcaactcagtgtaagaataaatttttacgtaatttttccttttacgga
gagttaaccgtgactattaaaaaagcactcattccggcagccggtttaggaacccgtttc
ctgcctgccactaagtccatgccaaaagaaatgctcccgatcattgacactcccgtcatc
cagtatgtcgtggaggaggctatagcctcagggatcgaggacataatcattatcactgga
agaggcaagagagccatcgaagattacttcgacgactcccctgaacttgaaatgcacctt
gcgaaaaagaaccagacagacatgttgaaactggtcagggacatctcctctcttgttgat
atccactatatccgccagaaagagcctaacgggcttggggatgcagttctcagggcagag
aaccatatcggaaatgaaccttttgcggtgcttctcggagacgacattatcgttaatgat
aaaccctgcactgcccagcttatcgagaactttgaaaaatacggaaggtcaaccatcgca
gttgaagaggtgccttacgaaaaactgaacagttacggaattataaagggcaggcctctt
gacgattccctgtacgtgcttgaggatatcgtggaaaaaccctctcccgaagaggctcct
tctaatatcggggcaattgggcgctacgttttcactcctgaaatttttgattgcattaaa
aaagccggaaccggagtggggagcgagatccagcttacggacggcatcaggctcctgagc
aggtctcagatgatctacgcttgcaggttcaaaggaaaaaggttcgatacgggagaccga
cttggatatataaaatctataatcgactttgcccttcagaacgaaagcctcagagacaat
gtacttgagtacctgcgggaaatcctggcagttgaaaaggtcacggcagaaaagtaa

DBGET integrated database retrieval system