KEGG   Methanosarcina acetivorans: MA4607Help
Entry
MA4607            CDS       T00080                                 

Gene name
tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mac  Methanosarcina acetivorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MA4607 (tpi)
   01230 Biosynthesis of amino acids
    MA4607 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MA4607 (tpi)
   00051 Fructose and mannose metabolism
    MA4607 (tpi)
   00562 Inositol phosphate metabolism
    MA4607 (tpi)
Enzymes [BR:mac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MA4607 (tpi)
Exosome [BR:mac04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MA4607 (tpi)
  Exosomal proteins of bladder cancer cells
   MA4607 (tpi)
  Exosomal proteins of melanoma cells
   MA4607 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5683577..5684245)
Genome map
AA seq 222 aa AA seqDB search
MGSPFILLNYKTYNQGTGQGAVEIARACRAVSEESGIEIAVAPQLPDIYRVASEVELPIF
SQHMDGVGAGSFTGHVFGKCIKEAGAVGTLINHSERRLTLAEIEASLKAAKEFGLRAVIC
TNNVPTTAAAAALEPDYVAIEPPELIGSGIPVSKADPEVVSGSVEAVAKINSGVKVLCGA
GISKGEDLRAALDLGSQGVLLASGIVKAADPKAALEDLIRLV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgggttcaccattcattttactgaattataagacttataatcagggcacaggccaggga
gcagtggaaattgccagagcctgcagagccgtatccgaagaatcaggtatcgagattgca
gtagctccacagcttccggacatttacagggtagcttcggaagttgaacttccgattttt
tcccagcatatggacggagtaggggcaggaagctttacaggccatgttttcggaaaatgc
ataaaagaagcaggagctgtcgggactctgatcaaccactctgaaaggcgtctgaccctt
gcggaaattgaggcatccttaaaggcggcaaaagaattcgggctaagagcggttatctgc
accaataacgtccctacaactgcagcagctgcagcccttgagccagactatgtagcaatc
gaaccaccggagctcataggcagtggaattcctgtctcaaaagccgaccctgaagttgtc
agcggttcggttgaagccgttgcaaagatcaattccggagtaaaagtgctttgcggtgcc
ggaatttcaaaaggtgaagacctcagggcagcccttgaccttggctcgcagggtgtactc
cttgcttccggaatcgtgaaagctgcagaccctaaggctgcccttgaagaccttattcgc
ctggtttaa

DBGET integrated database retrieval system