KEGG   Marinobacter adhaerens: HP15_1114Help
Entry
HP15_1114         CDS       T01922                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mad  Marinobacter adhaerens
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mad00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mad00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mad00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:mad00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:mad00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1141121..1142056
Genome map
AA seq 311 aa AA seqDB search
MSKKIKAAIIGSGNIGTDLMIKILRNGKNIEMGAMVGIDPESDGLARAARMGVATTHEGV
DGLVKMPEFADIDIVFDATSARAHRHNEVFLRGHKETIKIIDMTPAAIGPYCVPVVNLER
NLAEGNVNMVTCGGQATIPMVAAVSRVAKAHYAEIVASISSKSAGPGTRANIDEFTETTS
RAIEVVGGAQKGKAIIILNPAEPPLLMRDTVYVLSDAADKAEVEASVEEMVKAVNSYVPG
YRLKQKVQFDDIPEDQPMNVPGLGRFSGLKTSIFLEVEGAAHYLPAYAGNLDIMTSAALG
TAERIAESLVN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaaatcaaggcagcgatcatcggctcgggcaacatcggcaccgacctgatg
atcaagatcctgcgcaacggcaagaacattgaaatgggagccatggtcggtatcgatccg
gagtcggacggccttgcccgtgccgcccggatgggcgtggccacgacccatgaaggcgtg
gacggcctggtgaagatgccggagtttgccgacatcgacattgtgttcgatgccacctct
gcgagggctcataggcacaacgaagtgttcctgcggggccataaagagaccatcaagatc
atcgacatgaccccggcggccatcggtccctactgcgtgccggtggtcaatctggagcgg
aacctggccgaaggtaacgtcaacatggtcacctgcggcggtcaggccaccattcccatg
gtggcggcggtgtcccgggtagccaaggctcactacgccgagattgtggcctccatctcc
agcaagtcggccggccccggcacccgtgccaacatcgacgaatttaccgaaacaacctcc
cgggctatcgaagtagtcggcggcgcgcagaagggtaaggccatcatcattctgaatccg
gccgagccaccgctactgatgcgggataccgtctacgtactttcggatgccgccgacaag
gccgaagtggaagcctccgtggaagagatggtcaaggccgtcaacagctacgtgccgggc
taccgcctcaagcagaaagtgcagttcgacgacatccccgaagaccagcccatgaacgtc
ccgggcctgggtcgcttcagcggcctgaagacttccatcttcctggaggtcgagggcgcc
gcccattacctgccggcctacgccggaaacctggacatcatgacctccgcggcactcggc
accgccgagcgcatcgccgaatcgctggtcaactga

DBGET integrated database retrieval system