KEGG   Marinobacter adhaerens: HP15_1148Help
Entry
HP15_1148         CDS       T01922                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mad  Marinobacter adhaerens
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HP15_1148
Enzymes [BR:mad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     HP15_1148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1182134..1183873
Genome map
AA seq 579 aa AA seqDB search
MTQALKAKLVSMLDVVYPELDCDFLAEQLLTTMGLEPNQAPPPAHQNNWDESDVVLITYA
DTVQRAEEKPLQTLHRFLADCLSDSISSVHILPFFPYSSDDGFSVMDYLAVNESHGNWED
IEGIARDYKLMADLVINHMSARSRWFENFRKRVDPGKDYFFEGNPRDDLSAVVRPRTSPL
LNPVQTDDGERYVWCTFSEDQVDLNFANPKVLIEFAAIIRRYLERGIIIFRLDAVAFLWK
EPGTPCIHLQQTHELIKILRLLIEHHSPDAVVITETNVPNRENLTYFGNANEAHVIYNFS
LPPLLINTLVTGDCKHLKTWLMSMPPAQMGTTYLNFIASHDGVGMRPTDGLLTEEEKQRL
INTMDSFGGKVSYRRTPDGRDQPYEINIALYDALQGTAESGRDHWQLQRFVCAHTVMLAL
EGIPAFYIHSLLATENDLERVEHTGRLRSINRSQWQLDTLEQKLADPLSHHSKAFQELKR
LIAIRRKQPAFHPNATQFTLHLGLQLFGFWRQSMRRDQSIFCIHNISNEVQQVALSDINL
IGTDHWLDLISGMTIDDLSGSITLKPYQSVWLSNLEVTG
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctctgaaagcgaagctggtttccatgctggatgtcgtctatccagagctg
gactgtgactttctggccgaacagttgctgaccactatgggtctggagcccaaccaggcc
ccgccgcctgcgcaccagaataactgggatgaatcggatgtggtgctgattacctatgcc
gatacggttcagcgggcggaagaaaaaccactgcagacattgcatcggttcctcgcggat
tgcctgtcagattcaatttcttcggtgcacattctgccgtttttcccctacagctccgac
gacggtttctcggtcatggattatctggccgtcaacgagtcccacggaaactgggaggat
atcgagggcatcgcccgggattacaagctgatggcggacctggtgatcaaccatatgtcg
gcccgcagccgctggttcgagaatttccgcaaacgggtagacccgggcaaggattatttc
ttcgagggcaatccaagggatgatctgagtgccgttgtgcggccccgtacctcaccgctc
cttaacccggtccagaccgatgatggcgagcgatatgtctggtgtacgttcagtgaggat
caggttgacctgaattttgccaacccgaaggtgctcatcgagtttgctgctatcatccgg
cgctatctggagcgtggcattatcatcttccggctcgatgccgtcgcctttctctggaaa
gagccgggcacgccctgcatccatctgcagcaaacccatgagctgatcaagatcctgcgc
cttctgatcgagcaccacagcccggatgcggtggtgattaccgagaccaacgtacccaac
cgcgaaaatctcacctatttcggcaacgccaacgaagcccatgtaatctataacttttcc
ctgccgcccctgctgatcaataccctggttaccggtgactgcaagcacctgaaaacctgg
ctgatgagcatgccgcccgcgcagatgggcaccacctatctgaattttattgcgtcccac
gatggtgtgggtatgcggccaacggatggtctgctgacggaggaagagaagcagcggctg
atcaacaccatggactcgttcggcggcaaggtctcgtaccggcgcacgccggatggccgc
gaccagccctatgaaatcaacatcgccctgtacgatgcgctgcagggcacggcggagtcg
ggtcgggatcactggcagttgcagcgcttcgtctgcgcccacaccgtaatgctggcgctg
gaggggattccggccttctacattcacagtctgctggcgactgagaacgatctggagcgg
gtggagcacaccggtcggcttcgatccattaaccgcagccagtggcaactggatactctg
gagcagaagctcgcagatcccctgagccaccacagcaaggcgttccaggagctgaaacgg
ctgattgccatccggcgtaaacagccagcgtttcacccgaacgccacccagttcaccctg
catcttggcctgcagctgtttggtttctggcgccagagtatgcgccgggaccagtccatc
ttctgcattcacaacatcagtaacgaggtacagcaggtagcgctgagcgacatcaatctc
atcggcaccgatcattggctggatctgatttccggtatgactattgatgatctgtctggc
tcgatcaccctgaaaccttatcagagtgtgtggctgtccaacctggaagttaccggctga

DBGET integrated database retrieval system