KEGG   Marinobacter adhaerens: HP15_1159Help
Entry
HP15_1159         CDS       T01922                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mad  Marinobacter adhaerens
Pathway
mad00300  Lysine biosynthesis
mad01100  Metabolic pathways
mad01120  Microbial metabolism in diverse environments
mad01230  Biosynthesis of amino acids
Module
mad_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HP15_1159 (dapE)
Enzymes [BR:mad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HP15_1159 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ADP96923
UniProt: E4PGY7
Position
complement(1191502..1192638)
Genome map
AA seq 378 aa AA seqDB search
MQTTDSPTLELAVDLIRRPSVTPDDAGCQELMMSRLAPLGFTGENLRFGDTDNLWARKGS
EGPVLAFAGHTDVVPTGPEKNWSHPPFDPVIRDGYLLGRGAADMKGSLAAFVTACERFVA
SYPDHRGSIALLITSDEEGPAQHGTVKVVETLEARNEKIDWCLIGEPSSTREVGDVIKNG
RRGSLHGYLTVHGVQGHVAYPHLAENPVHLVAPALDALAKEFWDNGNDFFPPTTFQITKL
EAGTGSNIIPGECLVHFNFRYCTENTAESLEERVVAILDRHNLKYDLQWHLSGRPFLTDK
GALVSASQSAIRTVTGRETELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVDECVKAD
DLNTLSEIYEQILIELLA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaactgattccccgaccctcgaacttgccgttgatctgatccgccggccgtct
gtcacgccagacgatgccggctgtcaggaactgatgatgtcgcgccttgcgcctctgggc
ttcaccggcgagaacctgcgctttggcgataccgataacctctgggcccgaaagggctcc
gaggggccggtactggcctttgccggccataccgatgtggtaccaaccgggccggaaaag
aactggtcgcacccaccctttgatcccgtgatcagggatggctaccttctcggccgtggc
gccgcggacatgaagggcagcctggcagccttcgtaactgcctgcgagcgcttcgttgca
agctacccggaccatcggggttccatagccctgctgattaccagtgacgaagaggggcca
gcccaacacggcacggtcaaagtggtggaaactctcgaagccaggaacgaaaagatcgac
tggtgcctgattggcgagccgtccagcacccgagaagtgggtgatgtgatcaagaatggt
cgacggggctctctgcatggttacctgaccgtgcatggggttcagggccacgtagcctat
ccgcacctggccgagaacccggttcacctggttgcgcctgccctggatgcgctggcaaag
gagttctgggataacggcaacgacttcttcccgccaaccaccttccagatcaccaagctg
gaggccggtacgggcagcaacattattcccggtgaatgcctggtgcacttcaacttccgc
tactgcacggaaaacactgcagaaagtctggaggaacgggtggtagccatcctggaccgc
cacaacctgaaatacgatctgcagtggcacctcagtggccgtccgttcctgacggacaag
ggcgcactcgtgtctgccagccagagcgccattcgcacggtgacaggccgggaaaccgaa
ctttcaacctccggcggcacctcggatggtcgcttcattgcacctaccggcgcgcaggtg
gtcgaacttggccccatcaatgcgaccattcacaaagtggatgagtgcgtaaaggccgac
gatttgaataccctgtctgaaatctacgaacagattctgatcgaactgctggcataa

DBGET integrated database retrieval system