KEGG   Marinobacter adhaerens: HP15_1280Help
Entry
HP15_1280         CDS       T01922                                 

Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mad  Marinobacter adhaerens
Brite
Enzymes [BR:mad01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HP15_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1340662..1341318
Genome map
AA seq 218 aa AA seqDB search
MTAQLEGIGMTSRRTRMRLVQRLREAGIESDRVLEIMGEVPRHIFLDEALSHRAYEDTSL
PIGYGQTLSQPYIVARMTELMLAHGPSRVLELGTGSGYQTSVLSRLFAEIYSVERIKALQ
DRARDRLRQLNARNVFLKHADGGMGWPERGPFDGIIVTAAPIEVPAELLAQLADGGVLIA
PVGEENQVLVQVTRRGDRFDHKELEPVRFVPLLGGVVR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgcagctcgaaggcatcgggatgacctcccgacgcacccggatgcgactggtt
cagcgcctcagggaagccggcatcgagtcggaccgggtacttgagattatgggagaggtg
ccacggcacattttcctggatgaggcgctttcccatagagcctacgaagatacatcgcta
ccgattggctacggccaaaccttgtcacagccctacatagtggcccgcatgactgaatta
atgcttgcccacgggccctcacgggtcctggagcttggcaccgggtccggttaccagacc
tcggtgctctcccgcctgttcgccgaaatctacagcgtcgagcgtatcaaggcgcttcag
gacagggcccgggaccggttgcgacaactgaacgccagaaacgtgttcctgaaacatgct
gatggtggcatgggctggcctgaacgtggccctttcgacggcattatcgtgaccgcagca
cccattgaagttccagccgaattgctcgcccaactggcagacggtggcgtgttgattgcc
cctgtcggtgaggagaaccaggtgctggtgcaggtaacccggcggggagatcgctttgat
cacaaggagctggaaccggtccggtttgtgccgcttctgggcggggttgtccgataa

DBGET integrated database retrieval system