KEGG   Marinobacter adhaerens: HP15_1384Help
Entry
HP15_1384         CDS       T01922                                 

Definition
lipolytic protein G-D-S-L
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mad  Marinobacter adhaerens
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mad01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1459300..1459887)
Genome map
AA seq 195 aa AA seqDB search
MFAVLALPAVASQNTLLIVGDSLSAAYGVPSETAWVQLLRNRLESKGLNDWEVVNASISG
ETTDGGARRLPDLLEENEPDVVVIELGGNDGLRGFPPNVIESNLASMIEKVQTSGARAVL
VGMQIPPNYGQRYTEMFAEIYPKLSDRYDTALVPFFLDGIYNQAGLMQDDGIHPTEEAQG
KLLENVWPVLKPILQ
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgccgtgctggcgctgccggcagtggccagtcagaatacgctgctcatcgtaggt
gacagcctcagtgcggcctatggagtgccctccgaaactgcctgggtgcagttgctgaga
aaccggctcgagagcaaagggttgaacgactgggaggtggtcaatgccagcatcagcgga
gaaaccacggatggcggtgcccgccggctgcctgatctccttgaggagaacgagcccgac
gtcgtggtcattgaattgggtggcaatgatggccttcgcggctttccccccaacgtaatc
gaatccaatctcgcctccatgatcgaaaaggtgcagacctcgggtgctcgcgccgtactg
gtgggcatgcagataccgcccaactacggacagcgctacacagagatgtttgccgaaatc
tatccgaagctgtctgaccgatacgacaccgcgttggttccctttttcctggacggcatc
tacaaccaggccgggctgatgcaggacgacgggattcacccgaccgaggaagcccagggc
aaactgctggagaatgtctggccggtactcaaaccgatcctgcaataa

DBGET integrated database retrieval system