KEGG   Marinobacter adhaerens: HP15_1384Help
Entry
HP15_1384         CDS       T01922                                 

Definition
lipolytic protein G-D-S-L
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mad  Marinobacter adhaerens
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    HP15_1384
Enzymes [BR:mad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HP15_1384
   3.1.2  Thioester hydrolases
    3.1.2.-  
     HP15_1384
Lipid biosynthesis proteins [BR:mad01004]
 Fatty acid synthase
  Component type
   HP15_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1459300..1459887)
Genome map
AA seq 195 aa AA seqDB search
MFAVLALPAVASQNTLLIVGDSLSAAYGVPSETAWVQLLRNRLESKGLNDWEVVNASISG
ETTDGGARRLPDLLEENEPDVVVIELGGNDGLRGFPPNVIESNLASMIEKVQTSGARAVL
VGMQIPPNYGQRYTEMFAEIYPKLSDRYDTALVPFFLDGIYNQAGLMQDDGIHPTEEAQG
KLLENVWPVLKPILQ
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgccgtgctggcgctgccggcagtggccagtcagaatacgctgctcatcgtaggt
gacagcctcagtgcggcctatggagtgccctccgaaactgcctgggtgcagttgctgaga
aaccggctcgagagcaaagggttgaacgactgggaggtggtcaatgccagcatcagcgga
gaaaccacggatggcggtgcccgccggctgcctgatctccttgaggagaacgagcccgac
gtcgtggtcattgaattgggtggcaatgatggccttcgcggctttccccccaacgtaatc
gaatccaatctcgcctccatgatcgaaaaggtgcagacctcgggtgctcgcgccgtactg
gtgggcatgcagataccgcccaactacggacagcgctacacagagatgtttgccgaaatc
tatccgaagctgtctgaccgatacgacaccgcgttggttccctttttcctggacggcatc
tacaaccaggccgggctgatgcaggacgacgggattcacccgaccgaggaagcccagggc
aaactgctggagaatgtctggccggtactcaaaccgatcctgcaataa

DBGET integrated database retrieval system