KEGG   Marinobacter adhaerens: HP15_1512Help
Entry
HP15_1512         CDS       T01922                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
mad  Marinobacter adhaerens
Pathway
mad00071  Fatty acid degradation
mad00280  Valine, leucine and isoleucine degradation
mad00281  Geraniol degradation
mad00310  Lysine degradation
mad00362  Benzoate degradation
mad00380  Tryptophan metabolism
mad00410  beta-Alanine metabolism
mad00640  Propanoate metabolism
mad00650  Butanoate metabolism
mad00903  Limonene and pinene degradation
mad00930  Caprolactam degradation
mad01040  Biosynthesis of unsaturated fatty acids
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01120  Microbial metabolism in diverse environments
mad01130  Biosynthesis of antibiotics
mad01200  Carbon metabolism
mad01212  Fatty acid metabolism
Module
mad_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HP15_1512
   00650 Butanoate metabolism
    HP15_1512
  Lipid metabolism
   00071 Fatty acid degradation
    HP15_1512
   01040 Biosynthesis of unsaturated fatty acids
    HP15_1512
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HP15_1512
   00310 Lysine degradation
    HP15_1512
   00380 Tryptophan metabolism
    HP15_1512
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HP15_1512
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HP15_1512
   00281 Geraniol degradation
    HP15_1512
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HP15_1512
   00930 Caprolactam degradation
    HP15_1512
Enzymes [BR:mad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     HP15_1512
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HP15_1512
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     HP15_1512
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     HP15_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 SDH_sah Spidroin_N
Motif
Other DBs
NCBI-ProteinID: ADP97276
UniProt: E4PL68
Position
1588416..1590563
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKEIEGGIAQLNFDLQGESVNKFNRLTIEELRAATDALKAQKNLKGLVVTS
SKDSFIVGADITEFTELFAGSEEDLVANNLKANEVFNAVEDLPFPTVTAINGMALGGGFE
MCLATDYRVMDKKAKVGLPEVKLGIFPGFGGTVRLSRLVGVDNAVEWISGGTENRADVAL
KVGAVDAVLDSDKLVDAAVAIINQCNEGKLDHEARREEKKGKIKLNAMESMMAFEISKAF
VAGKAGKNYPAPVEAIKVMQKHAGMTRDKAIEVEAKGFAKMAKTNVAACLVGLFLNDQEL
KKKAKAWEKEANDVNLAAVLGAGIMGGGVAFQSALKGTPIIMKDINQDGIALGLKEAKKL
LSKRVEKGKMKPDQMADVLNSITPTLNYGDFKNVDLVVEAVVENPKVKDAVLRETEDAVR
EDTILTSNTSTISIDLLAKNLKRPENFCGMHFFNPVHMMPLVEVIRGEKTSDRAIATTVA
YAKAMGKTPIVVNDCPGFLVNRVLFPYFGGFIGLVRDGADFQHVDKVMEKFGWPMGPAYL
LDVVGMDTGKHAGEVMADGFPDRMKHEGTTAIDVMFDNNRYGQKNDKGFYKYELDRKGKQ
KKVVDEETYKLLEPVVQGKNEFSEEDIIARMMIPLCLETVRCLEDGIVEDPADADMGLIF
GIGFPPFRGGALRYIDDMGVDKFVELADKFADLGPLYHPTEKLREMAKTGKKFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaagagatcgaaggcgggatcgctcagttg
aacttcgacttgcagggcgagtcagtaaacaagttcaaccgtcttactattgaagagctc
cgcgccgcgactgacgcactgaaagcgcagaagaacctgaagggtctggtagtcaccagc
tccaaggacagcttcattgttggtgccgacattaccgaattcaccgagctttttgcaggc
tcggaagaggatctggtagccaacaacctcaaggctaacgaagtcttcaacgctgttgaa
gatctgccgttccccaccgttaccgcgatcaacggtatggcgctgggtggcggtttcgaa
atgtgtcttgcaaccgactaccgcgtgatggacaagaaggccaaggttggtcttccggaa
gtgaagcttggcatcttcccgggctttggcggtaccgtgcgtctgtcccgtctggttggc
gtggacaatgccgtcgagtggatcagcggtggtaccgagaaccgtgctgatgtcgctctg
aaagtcggcgctgtcgatgccgtgctcgattccgacaagctggtcgatgctgctgttgcc
attattaaccagtgcaacgaaggcaagctggaccacgaagcccgtcgtgaagagaagaag
ggcaagatcaagctcaatgccatggaaagcatgatggcattcgagatttccaaggcgttt
gttgctggcaaggctggcaagaactacccggctcctgtcgaggccatcaaggttatgcag
aagcatgccggcatgacccgcgacaaggcaatcgaagtcgaagccaaaggcttcgccaag
atggccaagaccaatgtggcggcctgcctggttggtctgttcctgaacgatcaggaattg
aagaagaaggccaaggcctgggaaaaagaagctaacgacgtgaacctggctgccgttctg
ggtgccggtatcatgggtggtggtgttgcattccagtctgccctgaaaggcacgccgatc
atcatgaaggacatcaaccaggacggcatcgccctgggtctgaaagaagccaagaagctt
ctgtccaagcgtgttgaaaaaggaaagatgaagccggatcagatggccgacgtgctcaac
agcatcacgccgaccctgaactatggcgacttcaagaatgtagacctggtggttgaagcg
gttgttgaaaacccgaaggtgaaagatgcggttctgcgtgaaaccgaagatgcggttcgc
gaggacaccatcctgacctccaacacctcgacgatttccatcgacctgctggccaagaac
ctgaagcgtccggaaaacttctgcggcatgcacttcttcaacccggtgcacatgatgccg
ctggttgaggtaatccgtggcgagaagaccagtgatcgcgccattgcaaccacggttgcc
tacgccaaggccatgggcaagaccccgatcgttgtaaacgattgcccgggcttcctggtc
aaccgtgttctgttcccgtacttcggcggctttatcggcctggtacgtgacggtgctgac
ttccagcacgttgacaaggttatggaaaagttcggctggcccatgggtcctgcgtacctg
ctggacgtggtcggcatggataccggcaagcacgctggcgaagtaatggcagacggcttc
ccggatcggatgaagcacgaaggtacaaccgccattgacgtaatgttcgataacaaccgt
tacggacagaagaacgacaagggcttctacaagtatgaactggaccgcaagggcaagcag
aagaaggttgtcgacgaagagacctacaagctgctcgagcctgttgttcagggtaagaac
gagttcagcgaagaagacatcatcgcccgtatgatgattcctctttgcctggaaaccgtt
cgctgcctggaagatggcattgtcgaagatccggcagatgctgatatgggcctgattttc
ggtatcggcttcccgccgttccgtggtggtgccctgcgctatatcgacgatatgggtgta
gacaagttcgtcgaactggcagacaagtttgcagaccttggtcctctttatcacccgacc
gagaagctgcgtgaaatggccaagactggcaaaaagttctttggctaa

DBGET integrated database retrieval system